| 1GAQ | |
| PDB ID | 1GAQ |
| Japanese name | トウモロコシ |
| English name | Corn |
| Scientific name | Zea mays L. |
| Protein name | Ferredoxin I, Chloroplast Precursor |
| Gene name | Name=Fdx1; Synonyms=Pfd1; |
| Source/Organism | Zea Mays |
| Compound | Molecule: Ferredoxin-Nadp+ Reductase; Chain: A, C; Synonym: Fnr; Engineered: Yes; Molecule: Ferredoxin I; Chain: B; Synonym: Fd; Engineered: Yes |
| Classification | Oxidoreductase/Electron Transport |
| EC number | 1.18.1.2 (Ferredoxin I) |
| Authors | G.Kurisu, M.Kusunoki, T.Hase |
| Reference | G.Kurisu, M.Kusunoki, E.Katoh, T.Yamazaki, K.Teshima, Y.Onda, Y.Kimata-Ariga, T.Hase Structure Of The Electron Transfer Complex Between Ferredoxin And Ferredoxin-Nadp+ Reductase Nat.Struct.Biol. V. 8 117 2001 |
| Key word | Oxidoreductase/Electron Transport |
| Cross reference | GB:BAA88236,6561889 SWS:FER1_MAIZE,P27787 EMBL; M73829; AAA33459.1; -. EMBL; M73830; AAA33460.1; -. PIR; T03286; T03286. PDB; 1GAQ; X-ray; B=53-150. MaizeDB; 66392; -. InterPro; IPR006057; 2Fe2S. InterPro; IPR006058; 2Fe2S_fd_BS. InterPro; IPR010241; Fdx_plant. InterPro; IPR001041; Ferredoxin. Pfam; PF00111; Fer2; 1. PRINTS; PR00159; 2FE2SFRDOXIN. TIGRFAMs; TIGR02008; fdx_plant; 1. PROSITE; PS00197; 2FE2S_FERREDOXIN; 1. |
| Experimental method | X-Ray Diffraction, Resolution: 2.59 Angstrom, R-Factor: 0.232, R-Free: 0.297 |
| Sequence characteristics | Length: 150 AA, Molecular weight: 15837 Da |
| Sequence | MATVLGSPRAPAFFFSSSSLRAAPAPTAVALPAAKVGIMGRSASSRRRLRAQATYNVKLI TPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQ IADGWVLTCHAYPTSDVVIETHKEEELTGA |
| Image |  |