1BE2 | |
PDB ID | 1BE2 |
Japanese name | 大麦 |
English name | Barley |
Scientific name | Hordeum vulgare l. |
Protein name | Nonspecific Lipid-Transfer Protein 1 Precursor |
Gene name | Name=Ltp1; Synonyms=Papi; |
Source/Organism | Hordeum Vulgare |
Compound | Molecule: Lipid Transfer Protein; Chain: Null; Synonym: Ltp |
Classification | Lipid Transport |
EC number | - |
Authors | M.H.Lerche, F.M.Poulsen |
Reference | M.H.Lerche, F.M.Poulsen Two Different Binding Modes Of Palmitate In The Homologous Maize And Barley Non-Specific Lipid Transfer Protein - Structure Of The Complex Of Barley Lipid Transfer Protein With Palmitate To Be Published |
Key word | Lipid Transport, Lipid Transfer Protein, Palmitate, Binding |
Cross reference | SWS:NLT1_HORVU,P07597 EMBL; M15207; AAA32970.1; -. EMBL; X05168; CAA28805.1; -. EMBL; X59253; CAA41946.1; -. EMBL; X60292; CAA42832.1; ALT_SEQ. PIR; S20507; S20507. PIR; T05947; T05947. PDB; 1BE2; NMR; @=27-117. PDB; 1JTB; NMR; @=27-117. PDB; 1LIP; NMR; @=27-117. InterPro; IPR003612; AAI. InterPro; IPR000528; Plant_LTP. Pfam; PF00234; Tryp_alpha_amyl; 1. PRINTS; PR00382; LIPIDTRNSFER. SMART; SM00499; AAI; 1. PROSITE; PS00597; PLANT_LTP; 1. |
Experimental method | Nmr, 10 Structures |
Sequence characteristics | Length: 117 AA, Molecular weight: 12301 Da |
Sequence | MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDL HNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRIY |
Image |