| 1CIR | |
| PDB ID | 1CIR |
| Japanese name | 大麦 |
| English name | Barley |
| Scientific name | Hordeum vulgare l. |
| Protein name | Subtilisin-Chymotrypsin Inhibitor-2a |
| Gene name | - |
| Source/Organism | Hordeum Vulgare |
| Compound | Molecule: Chymotrypsin Inhibitor 2; 1cir 5 Chain: A, B; 1cir 6 Domain: Residues 1 - 40, 41 - 64; 1cir 7 Synonym: Ci2; 1cir 8 Engineered: Yes; 1cir 9 Other_details: Cleaved Between Residues 40 And 41 1cir 10 |
| Classification | Serine Protease Inhibitor |
| EC number | - |
| Authors | B.J.Davis, A.R.Fersht 1cir 18 |
| Reference | B.Davis, A.M.Buckle, G.De Prat Gay, A.R.Fersht 1cir 20 Towards The Complete Structural Characterization 1cir 21 Of A Protein Folding Pathway. 2: Comparison Of The 1cir 22solution And Crystal Structures Of The Complex Of 1cir 23two Complementary Fragments Of Chymotrypsin 1cir 24inhibitor 2, A Cleaved Serine Protease Inhibitor 1cir 25to Be Published 1cir 26 |
| Key word | - |
| Cross reference | ICI2_HORVU:58,20 ICI2_HORVU:83,60 EMBL; X05404; CAA28988.1; -. PIR; A01292; EIBH2A. PDB; 1CIQ; X-ray; A=20-59, B=60-83. PDB; 1CIR; NMR; A=20-59, B=60-83. PDB; 1COA; X-ray; I=20-83. PDB; 1CQ4; X-ray; A=20-66, B=60-83. PDB; 1LW6; X-ray; I=20-83. PDB; 1YPA; X-ray; I=20-83. PDB; 1YPB; X-ray; I=20-83. PDB; 1YPC; X-ray; I=20-83. PDB; 2CI2; X-ray; I=1-83. PDB; 2SNI; X-ray; I=1-83. PDB; 3CI2; NMR; @=18-83. InterPro; IPR000864; Prot_inh_pot1. Pfam; PF00280; potato_inhibit; 1. PRINTS; PR00292; POTATOINHBTR. ProDom; PD002604; Prot_inh_pot1; 1. PROSITE; PS00285; POTATO_INHIBITOR; 1. |
| Experimental method | Nmr, 20 Structures 1cir 17 |
| Sequence characteristics | Length: 83 AA, Molecular weight: 9250 Da |
| Sequence | SSVEKKPEGVNTGAGDRHNLKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTME YRIDRVRLFVDKLDNIAQVPRVG |
| Image |  |