CBRC-AGAM-02-0158 | |
ID | CBRC-AGAM-02-0158 |
Pseudo | |
Novel | Novel |
Chromosome | 2R |
Level | B |
Family | UNKNOWN |
Alternativeproducts | |
Swiss-Prot BLAST top hit | TM16D_HUMAN [BLAST OUTPUT] |
Swiss-Prot BLAST top hit (E-value) | 2.8 |
Swiss-Prot BLAST top hit (Identity) | 30% |
NCBI nr-aa BLAST top hit | ref|ZP_01420534.1| conserved hypothetical protein [Caulobacter sp. K31] gb|EAU12018.1| conserved hypothetical protein [Caulobacter sp. K31] [BLAST OUTPUT] |
NCBI nr-aa BLAST top hit (E-value) | 5.2 |
NCBI nr-aa BLAST top hit (Identity) | 30% |
NCBI Unigene BLAST top hit | gnl|UG|Aga#S10992048 Single read from an extremity of a full-length cDNA clone made from Anopheles gambiae total adult females. 5-PRIME end of clone FK0AAC40BG09 of strain 6-9 of Anopheles gambiae (African malaria mosquito) /gb=BX060173 /gi=27633454 /ug=Aga.24321 /len=987 [BLAST OUTPUT] |
NCBI Unigene BLAST top hit (E-value) | 1.6 |
NCBI Unigene BLAST top hit (Identity) | 28% |
Expression | - |
Ligand | - |
G-protein coupling | - |
Sequence | MSFCVQHVTTTHRCVCVLTNVVYAKRVLLMGFCECSQPLSIATNNNNNNGRFHPFALVII LSNSTFYVLGKVLELLLGRWQGEVPARVQVRGSRELHACVTQAPITSDHLHCAHVFLSLS LSLFFEEQRVKRRNFPTANLWWKSSKVSFSSSLLRAQ |
Leftend | 48355438 |
Rightend | 48355911 |