| CBRC-OPRI-01-0327 | |
| ID | CBRC-OPRI-01-0327 |
| Pseudo | |
| Novel | Novel |
| Chromosome | UN |
| Level | B |
| Family | Odorant/olfactory and gustatory receptors |
| Alternativeproducts | |
| Swiss-Prot BLAST top hit | O52L1_HUMAN [BLAST OUTPUT] |
| Swiss-Prot BLAST top hit (E-value) | 4e-59 |
| Swiss-Prot BLAST top hit (Identity) | 85% |
| NCBI nr-aa BLAST top hit | ref|XP_521803.2| PREDICTED: similar to seven transmembrane helix receptor [Pan troglodytes] [BLAST OUTPUT] |
| NCBI nr-aa BLAST top hit (E-value) | 2e-60 |
| NCBI nr-aa BLAST top hit (Identity) | 87% |
| NCBI Unigene BLAST top hit | [BLAST OUTPUT] |
| NCBI Unigene BLAST top hit (E-value) | - |
| NCBI Unigene BLAST top hit (Identity) | - |
| Expression | - |
| Ligand | - |
| G-protein coupling | - |
| Sequence | MMSLSNSSWRLPQPTFFLVGIPGLEESQHWIALLLAVLYFLALSGNVTILFIVWVDSSLH QPMYLFLAMLAAIDLVLASSTAPKALAVLLIHAHEIGYICCLVQMFFIHAFSSMESGVLV AMALDRYVAYCTLCTTXXXXXXXX |
| Leftend | 4077 |
| Rightend | 4508 |