CBRC-PHAM-01-0419 | |
ID | CBRC-PHAM-01-0419 |
Pseudo | |
Novel | - |
Chromosome | UN |
Level | A |
Family | UNKNOWN |
Alternativeproducts | |
Swiss-Prot BLAST top hit | LANC1_HUMAN [BLAST OUTPUT] |
Swiss-Prot BLAST top hit (E-value) | 4e-91 |
Swiss-Prot BLAST top hit (Identity) | 100% |
NCBI nr-aa BLAST top hit | pdb|3E6U|A Chain A, Crystal Structure Of Human Lancl1 pdb|3E6U|C Chain C, Crystal Structure Of Human Lancl1 pdb|3E6U|B Chain B, Crystal Structure Of Human Lancl1 pdb|3E6U|D Chain D, Crystal Structure Of Human Lancl1 pdb|3E73|A Chain A, Crystal Structure Of Human Lancl1 Complexed With Gsh pdb|3E73|B Chain B, Crystal Structure Of Human Lancl1 Complexed With Gsh [BLAST OUTPUT] |
NCBI nr-aa BLAST top hit (E-value) | 6e-90 |
NCBI nr-aa BLAST top hit (Identity) | 100% |
NCBI Unigene BLAST top hit | [BLAST OUTPUT] |
NCBI Unigene BLAST top hit (E-value) | - |
NCBI Unigene BLAST top hit (Identity) | - |
Expression | - |
Ligand | - |
G-protein coupling | - |
Sequence | MPLHSSLGNKSETVSKEKKKKLHVLLTVVDETYFRLIHLNKIDPHAPNEMLYGRIGYIYA LLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGL AGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPG VIYMLIQAYKVLYVFLKKNF |
Leftend | 6444 |
Rightend | 10714 |