| CBRC-PMAR-01-0129 | |
| ID | CBRC-PMAR-01-0129 |
| Pseudo | |
| Novel | Novel |
| Chromosome | UN |
| Level | D |
| Family | UNKNOWN |
| Alternativeproducts | |
| Swiss-Prot BLAST top hit | RBM12_MOUSE [BLAST OUTPUT] |
| Swiss-Prot BLAST top hit (E-value) | 6e-09 |
| Swiss-Prot BLAST top hit (Identity) | 30% |
| NCBI nr-aa BLAST top hit | ref|XP_001626432.1| predicted protein [Nematostella vectensis] gb|EDO34332.1| predicted protein [Nematostella vectensis] [BLAST OUTPUT] |
| NCBI nr-aa BLAST top hit (E-value) | 1e-14 |
| NCBI nr-aa BLAST top hit (Identity) | 35% |
| NCBI Unigene BLAST top hit | gnl|UG|Pma#S35054108 PMAD-aap86c07.g1 Lamprey_WGS_pCMV-sport6 Petromyzon marinus cDNA 5' similar to ref|NP_005787.1| nuclear transport factor 2; placental protein 15 [Homo sapiens] >ref|NP_080808.1| nuclear transport factor 2 [Mus musculus] >ref|XP_214685.1| similar to nuc> /clone_end=5' /gb=DW023123 /gi=83672715 /ug=Pma.5151 /len=888 [BLAST OUTPUT] |
| NCBI Unigene BLAST top hit (E-value) | 0.002 |
| NCBI Unigene BLAST top hit (Identity) | 26% |
| Expression | - |
| Ligand | - |
| G-protein coupling | - |
| Sequence | MWTMTPAYNDLLLQIYATGSLTSTVKPTAGNFTANTPGPAWPTFTRACLAYIYPGCLAYI YPGLHDMHLPGPAWPTSTWACLAYIYPGLPGLHLPGPAWPTFTRACLAYIYPGLPGLHLP GPAWPTSTRACLAYIYPGLPGLHLPGPAWPTFTRACLAYITRACLAYIYPGLPGLHLPGP AWPTFTRACLAYIYLGLPGLHLPGPAWPTSTRACLAYIYPGLPDLHPKSVL |
| Leftend | 717 |
| Rightend | 1412 |