| 893696 | |
| Sequence ID | 893696 |
| Sequence Collection ID | 417 |
| New Approach | TMB |
| SOSUI | Non-TMH |
| Amino Acid | TMB |
| Dipeptide | TMB |
| Motif | TMB |
| SVM | Non-TMB |
| Header | >gi|6325114|ref|NP_015182.1| N-terminally acetylated ribosomal protein L37 of the large (60S) ribosomal subunit, nearly identical to Rpl33Bp and has similarity to rat L35a; rpl33a null mutant exhibits slow growth while rpl33a rpl33b double null mutant is inviable; Rpl33ap || |
| Sequence | MAESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAYVYRASKEVR GSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIFLYPSNI |