BP911437
Clone id YMU001_000005_A03
Library
Length 503
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000005_A03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAATCAACAGGTTGAATTTGGTGCGGTGCGGGCTGCACAAGAGGGAAGCCACTCCACTCC
TTTGTTATAGATTACCCCGATGGAAATAGAGTCACTAATTTCTCTATGAGATCTTAGCGA
TATTGACAAGTGAGATTGTTCTGTTGAATGACTTTATGAAAAGATGTACATTGAAATGGG
AATTCCTAAAATGAAGTCGTTACGTGTGCTCTCTCATGTGTGTATTGTTTAAGTGTTGGA
AAGATGAAATGACTGCAGCATTTTATCTAATCACCTGACAAGTGATGTGAATATGATAGT
ACCGAGATTTAGTACATCACGACATTGGCAAACAGATCAATGCGGTCTGGATGTGATTGC
TAAACAAGTTACAATGATCATGATTCTTATCTGAGATCTTGATGGGGATAACGGTGTGAA
TGTTCAGTGGCTGTCATCTTTGTGCAAGTACTGGATGTGTGCAGTCTAGTGTGTCAATAC
TTGGAGTCGGTGTCTACCGAGCT
■■Homology search results ■■ -
sp_hit_id Q8NI51
Definition sp|Q8NI51|BORIS_HUMAN Transcriptional repressor CTCFL OS=Homo sapiens
Align length 42
Score (bit) 30.0
E-value 5.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911437|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_A03.
(487 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8NI51|BORIS_HUMAN Transcriptional repressor CTCFL OS=Homo sa... 30 5.8
sp|A1AX20|EX7L_RUTMC Exodeoxyribonuclease 7 large subunit OS=Rut... 29 9.8

>sp|Q8NI51|BORIS_HUMAN Transcriptional repressor CTCFL OS=Homo
sapiens GN=CTCFL PE=2 SV=1
Length = 663

Score = 30.0 bits (66), Expect = 5.8
Identities = 16/42 (38%), Positives = 20/42 (47%)
Frame = -1

Query: 241 CSHFIFPTLKQYTHERAHVTTSF*EFPFQCTSFHKVIQQNNL 116
C H + KQ H AH+ T E PF C S +K +Q L
Sbjct: 488 CKHCSY-ACKQERHMTAHIRTHTGEKPFTCLSCNKCFRQKQL 528


>sp|A1AX20|EX7L_RUTMC Exodeoxyribonuclease 7 large subunit OS=Ruthia
magnifica subsp. Calyptogena magnifica GN=xseA PE=3 SV=1
Length = 466

Score = 29.3 bits (64), Expect = 9.8
Identities = 19/54 (35%), Positives = 27/54 (50%)
Frame = -3

Query: 251 DKMLQSFHLSNT*TIHT*ESTRNDFILGIPISMYIFS*SHSTEQSHLSISLRSH 90
DK+ H S T+H +S N L IPIS + S + H+SI+L +H
Sbjct: 273 DKLYMRLHQSYQQTLHDYQSVLNQLKLRIPISNKQIA-FFSQKLDHVSINLNNH 325


tr_hit_id B6MT62
Definition tr|B6MT62|B6MT62_BRAFL Putative uncharacterized protein OS=Branchiostoma floridae
Align length 102
Score (bit) 34.7
E-value 2.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911437|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_A03.
(487 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6MT62|B6MT62_BRAFL Putative uncharacterized protein OS=Branc... 35 2.5
tr|A3X9K4|A3X9K4_9RHOB Oxidoreductase, short chain dehydrogenase... 34 4.1

>tr|B6MT62|B6MT62_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_86387 PE=4 SV=1
Length = 425

Score = 34.7 bits (78), Expect = 2.5
Identities = 26/102 (25%), Positives = 46/102 (45%), Gaps = 1/102 (0%)
Frame = -2

Query: 441 HPVLAQR*QPLNIHTVIPIKISDKNHDHCNLFSNHIQTALICLPMS*CTKSRYYHIHI-T 265
H + R + +HT + I+ S C HI+ + + + C R H+ + T
Sbjct: 219 HTCMHIRRSHVGVHTCVHIRRSHVGVHTCM----HIRRSHVGVHT--CMHIRRSHVGVHT 272

Query: 264 CQVIR*NAAVISSFQHLNNTHMREHT*RLHFRNSHFNVHLFI 139
C IR + + + H+ +H+ HT +H R SH VH ++
Sbjct: 273 CMHIRRSHVGVHTCMHIRRSHVGVHT-CMHIRRSHVGVHTYM 313


>tr|A3X9K4|A3X9K4_9RHOB Oxidoreductase, short chain
dehydrogenase/reductase family protein OS=Roseobacter
sp. MED193 GN=MED193_07858 PE=3 SV=1
Length = 265

Score = 33.9 bits (76), Expect = 4.1
Identities = 17/37 (45%), Positives = 24/37 (64%)
Frame = -3

Query: 128 TEQSHLSISLRSHREISDSISIGVIYNKGVEWLPSCA 18
TEQS L+ + R+ DSI + VIYN G+ W+ +CA
Sbjct: 62 TEQSALAALCQRIRQEQDSIDL-VIYNAGITWIGACA 97