BP911439
Clone id YMU001_000005_A05
Library
Length 308
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000005_A05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TCAAAAGCATTACAGTATGTTTCAGGATGATGATAGAGCAATCGATGTGGAAGAGTGCCC
TATGTGTACCAGTGTAAGACTGGTTTATGATTGTACAAGAGAGAAATGCCAGCAGAAAAA
GGGAGTCGGGACCTATGATTGTCGGGCTTGTATTCTATGCATAGTTCGCTGTGAAGCGTG
TGGGAGATGCATCACCGACAATAATTATGAGGAAACCTTCTCTCTTGATGTTTTATGCTC
ATGTTGCTGGCTTGGCTCGCCTAAATGTGCAGAATGCAATAGGCCTGCTAGTGAGTGCGA
TCCGAATC
■■Homology search results ■■ -
sp_hit_id Q99750
Definition sp|Q99750|MDFI_HUMAN MyoD family inhibitor OS=Homo sapiens
Align length 56
Score (bit) 34.7
E-value 0.15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911439|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_A05.
(308 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q99750|MDFI_HUMAN MyoD family inhibitor OS=Homo sapiens GN=MD... 35 0.15
sp|P21849|TSA4_GIALA Major surface-labeled trophozoite antigen 4... 33 0.34
sp|Q2TGI5|ZDH24_RAT Probable palmitoyltransferase ZDHHC24 OS=Rat... 30 2.9
sp|Q6UX98|ZDH24_HUMAN Probable palmitoyltransferase ZDHHC24 OS=H... 30 3.8
sp|Q90827|NEL_CHICK Protein NEL OS=Gallus gallus GN=NEL PE=2 SV=1 30 3.8
sp|P55950|MT2_CALSI Metallothionein-2B OS=Callinectes sapidus PE... 30 3.8
sp|P02805|MT1_SCYSE Metallothionein-1 OS=Scylla serrata PE=1 SV=1 30 3.8
sp|Q5U2Z2|JUB_RAT Protein ajuba OS=Rattus norvegicus GN=Jub PE=1... 30 3.8
sp|Q91XC0|JUB_MOUSE Protein ajuba OS=Mus musculus GN=Jub PE=1 SV=1 30 3.8
sp|Q96IF1|JUB_HUMAN Protein ajuba OS=Homo sapiens GN=JUB PE=1 SV=1 30 3.8
sp|P07438|MT1B_HUMAN Metallothionein-1B OS=Homo sapiens GN=MT1B ... 30 4.9
sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-contai... 30 4.9
sp|P35556|FBN2_HUMAN Fibrillin-2 OS=Homo sapiens GN=FBN2 PE=1 SV=2 30 4.9
sp|Q6L1K9|DP2L_PICTO DNA polymerase II large subunit OS=Picrophi... 30 4.9
sp|Q9Y2M2|CC032_HUMAN Uncharacterized protein C3orf32 OS=Homo sa... 30 4.9
sp|Q95LZ5|TTC16_MACFA Tetratricopeptide repeat protein 16 OS=Mac... 29 6.4
sp|Q8NEE8|TTC16_HUMAN Tetratricopeptide repeat protein 16 OS=Hom... 29 6.4
sp|P25446|TNR6_MOUSE Tumor necrosis factor receptor superfamily ... 29 6.4
sp|Q61220|NELL2_MOUSE Protein kinase C-binding protein NELL2 OS=... 29 6.4
sp|P55945|MT_PSEAM Metallothionein OS=Pseudopleuronectes america... 29 6.4
sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-contai... 29 6.4
sp|P11046|LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melan... 29 6.4
sp|P15799|C170_GIALA Surface antigen CRP170 (Fragment) OS=Giardi... 29 6.4
sp|Q9LIH7|ZDHC7_ARATH Probable S-acyltransferase At3g18620 OS=Ar... 29 8.4
sp|A1SA65|PURA_SHEAM Adenylosuccinate synthetase OS=Shewanella a... 29 8.4
sp|Q5REV9|NPT2B_PONAB Sodium-dependent phosphate transport prote... 29 8.4
sp|O95436|NPT2B_HUMAN Sodium-dependent phosphate transport prote... 29 8.4
sp|A6QR11|NELL2_BOVIN Protein kinase C-binding protein NELL2 OS=... 29 8.4
sp|Q49180|MVHB_METFE Polyferredoxin protein mvhB OS=Methanotherm... 29 8.4
sp|Q6PZE0|MUC19_MOUSE Mucin-19 OS=Mus musculus GN=Muc19 PE=2 SV=2 29 8.4

>sp|Q99750|MDFI_HUMAN MyoD family inhibitor OS=Homo sapiens GN=MDFI
PE=1 SV=1
Length = 246

Score = 34.7 bits (78), Expect = 0.15
Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 2/56 (3%)
Frame = +2

Query: 140 CRACILC--IVRCEACGRCITDNNYEETFSLDVLCSCCWLGSPKCAECNRPASECD 301
C LC ++ C CG C ++++ LC CC GS +CA+C+ P CD
Sbjct: 174 CEFLTLCNIVLDCATCGSCSSEDS--------CLCCCC-CGSGECADCDLP---CD 217


>sp|P21849|TSA4_GIALA Major surface-labeled trophozoite antigen 417
OS=Giardia lamblia GN=TSA 417 PE=2 SV=1
Length = 713

Score = 33.5 bits (75), Expect = 0.34
Identities = 19/61 (31%), Positives = 25/61 (40%), Gaps = 2/61 (3%)
Frame = +2

Query: 38 AIDVEECPMCTSVRLVYDCTREKCQQ--KKGVGTYDCRACILCIVRCEACGRCITDNNYE 211
A D ECP ++R D T+ C + G G C+ C L I C C T Y
Sbjct: 437 ASDCTECPTGKALRYGDDGTKGTCGEGCTTGTGAGACKTCGLTIDGASYCSECATTTEYP 496

Query: 212 E 214
+
Sbjct: 497 Q 497


>sp|Q2TGI5|ZDH24_RAT Probable palmitoyltransferase ZDHHC24 OS=Rattus
norvegicus GN=Zdhhc24 PE=2 SV=1
Length = 284

Score = 30.4 bits (67), Expect = 2.9
Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 4/39 (10%)
Frame = +2

Query: 104 KCQQKKGVGTYDCRACILCIVR----CEACGRCITDNNY 208
+CQ + + C AC +CI+R C GRC+ +NY
Sbjct: 98 QCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFHNY 136


>sp|Q6UX98|ZDH24_HUMAN Probable palmitoyltransferase ZDHHC24 OS=Homo
sapiens GN=ZDHHC24 PE=2 SV=1
Length = 284

Score = 30.0 bits (66), Expect = 3.8
Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 4/39 (10%)
Frame = +2

Query: 104 KCQQKKGVGTYDCRACILCIVR----CEACGRCITDNNY 208
+CQ + + C AC +CI+R C GRC+ NY
Sbjct: 98 QCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFGNY 136


>sp|Q90827|NEL_CHICK Protein NEL OS=Gallus gallus GN=NEL PE=2 SV=1
Length = 816

Score = 30.0 bits (66), Expect = 3.8
Identities = 17/66 (25%), Positives = 27/66 (40%)
Frame = +2

Query: 47 VEECPMCTSVRLVYDCTREKCQQKKGVGTYDCRACILCIVRCEACGRCITDNNYEETFSL 226
++ C C ++ DC C + DC +L C C RC+TD +T
Sbjct: 716 IQNCQQCRCLQGEVDCWPLPCPE------VDCEFSVLPENEC--CPRCVTDPCQADTIRN 767

Query: 227 DVLCSC 244
D+ +C
Sbjct: 768 DITKTC 773


>sp|P55950|MT2_CALSI Metallothionein-2B OS=Callinectes sapidus PE=1
SV=1
Length = 58

Score = 30.0 bits (66), Expect = 3.8
Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 4/56 (7%)
Frame = +2

Query: 92 CTREKCQQKKGVGTYDCRACILCIVRCEACGRCITD----NNYEETFSLDVLCSCC 247
C +KC+ K+G C+ C C RC C +C ++ + E + + CSCC
Sbjct: 5 CCNDKCECKEGECKTGCK-CKSC--RCPPCDKCSSECKCTSKEECSKTCSKPCSCC 57


>sp|P02805|MT1_SCYSE Metallothionein-1 OS=Scylla serrata PE=1 SV=1
Length = 58

Score = 30.0 bits (66), Expect = 3.8
Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 4/56 (7%)
Frame = +2

Query: 92 CTREKCQQKKGVGTYDCRACILCIVRCEACGRCITD----NNYEETFSLDVLCSCC 247
C +KC K+G C+ C C RC C +C + N E + + CSCC
Sbjct: 4 CCNDKCVCKEGGCKEGCQ-CTSC--RCSPCEKCSSGCKCANKEECSKTCSKACSCC 56


>sp|Q5U2Z2|JUB_RAT Protein ajuba OS=Rattus norvegicus GN=Jub PE=1
SV=1
Length = 548

Score = 30.0 bits (66), Expect = 3.8
Identities = 24/81 (29%), Positives = 34/81 (41%), Gaps = 2/81 (2%)
Frame = +2

Query: 50 EECPMCTSVRLVYDCTREKCQQKKGVGTYDCRACILCIVRCEACGRCITDNNYEETFSLD 229
E+C +C + L EK Q G + C CIV C +C+ + FS
Sbjct: 411 EKCCVCGHLIL------EKILQAMGKSYHP--GCFRCIV----CNKCLDGVPFTVDFSNQ 458

Query: 230 VLCSCCWLG--SPKCAECNRP 286
V C + +PKCA C +P
Sbjct: 459 VYCVTDYHKNYAPKCAACGQP 479


>sp|Q91XC0|JUB_MOUSE Protein ajuba OS=Mus musculus GN=Jub PE=1 SV=1
Length = 547

Score = 30.0 bits (66), Expect = 3.8
Identities = 24/81 (29%), Positives = 34/81 (41%), Gaps = 2/81 (2%)
Frame = +2

Query: 50 EECPMCTSVRLVYDCTREKCQQKKGVGTYDCRACILCIVRCEACGRCITDNNYEETFSLD 229
E+C +C + L EK Q G + C CIV C +C+ + FS
Sbjct: 410 EKCCVCGHLIL------EKILQAMGKSYHP--GCFRCIV----CNKCLDGVPFTVDFSNQ 457

Query: 230 VLCSCCWLG--SPKCAECNRP 286
V C + +PKCA C +P
Sbjct: 458 VYCVTDYHKNYAPKCAACGQP 478


>sp|Q96IF1|JUB_HUMAN Protein ajuba OS=Homo sapiens GN=JUB PE=1 SV=1
Length = 538

Score = 30.0 bits (66), Expect = 3.8
Identities = 24/81 (29%), Positives = 34/81 (41%), Gaps = 2/81 (2%)
Frame = +2

Query: 50 EECPMCTSVRLVYDCTREKCQQKKGVGTYDCRACILCIVRCEACGRCITDNNYEETFSLD 229
E+C +C + L EK Q G + C CIV C +C+ + FS
Sbjct: 401 EKCCVCGHLIL------EKILQAMGKSYHP--GCFRCIV----CNKCLDGIPFTVDFSNQ 448

Query: 230 VLCSCCWLG--SPKCAECNRP 286
V C + +PKCA C +P
Sbjct: 449 VYCVTDYHKNYAPKCAACGQP 469


tr_hit_id A9S5J7
Definition tr|A9S5J7|A9S5J7_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 88
Score (bit) 119.0
E-value 8.0e-26
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911439|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_A05.
(308 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9S5J7|A9S5J7_PHYPA Predicted protein OS=Physcomitrella paten... 119 8e-26
tr|A7QBT8|A7QBT8_VITVI Chromosome chr1 scaffold_75, whole genome... 109 8e-23
tr|Q7EY67|Q7EY67_ORYSJ F-box protein family-like protein OS=Oryz... 103 6e-21
tr|Q0J5K5|Q0J5K5_ORYSJ Os08g0428100 protein OS=Oryza sativa subs... 103 6e-21
tr|A7P3T3|A7P3T3_VITVI Chromosome chr1 scaffold_5, whole genome ... 103 6e-21
tr|A3BTB7|A3BTB7_ORYSJ Putative uncharacterized protein OS=Oryza... 103 6e-21
tr|A7PLU8|A7PLU8_VITVI Chromosome chr14 scaffold_21, whole genom... 102 7e-21
tr|Q9LU91|Q9LU91_ARATH Gb|AAD12709.1 (At3g26000) (AT3g26000/MPE1... 102 1e-20
tr|B8BB00|B8BB00_ORYSI Putative uncharacterized protein OS=Oryza... 101 2e-20
tr|B4FSX1|B4FSX1_MAIZE Putative uncharacterized protein OS=Zea m... 100 3e-20
tr|Q8L720|Q8L720_ARATH Expressed protein OS=Arabidopsis thaliana... 100 4e-20
tr|A5C5I1|A5C5I1_VITVI Putative uncharacterized protein OS=Vitis... 88 2e-16
tr|B4FEB5|B4FEB5_MAIZE Putative uncharacterized protein OS=Zea m... 82 2e-14
tr|Q9ZU90|Q9ZU90_ARATH Expressed protein (Putative uncharacteriz... 80 4e-14
tr|Q8LGD0|Q8LGD0_ARATH Putative uncharacterized protein OS=Arabi... 80 4e-14
tr|Q7X920|Q7X920_ORYSJ Os04g0485800 protein OS=Oryza sativa subs... 77 3e-13
tr|A2XUU3|A2XUU3_ORYSI Putative uncharacterized protein OS=Oryza... 77 3e-13
tr|Q9LK24|Q9LK24_ARATH Genomic DNA, chromosome 3, TAC clone:K17E... 63 6e-09
tr|A0DX82|A0DX82_PARTE Chromosome undetermined scaffold_68, whol... 43 0.009
tr|A0DX80|A0DX80_PARTE Chromosome undetermined scaffold_68, whol... 43 0.009
tr|A0ELV1|A0ELV1_PETIN Non-S-locus F-box-like protein 2411 (Frag... 42 0.012
tr|A9G4H8|A9G4H8_SORC5 Putative secreted protein OS=Sorangium ce... 38 0.22
tr|Q7Q5W4|Q7Q5W4_ANOGA AGAP006168-PA OS=Anopheles gambiae GN=AGA... 37 0.50
tr|Q244X3|Q244X3_TETTH Zinc finger domain, LSD1 subclass family ... 37 0.50
tr|Q22AR2|Q22AR2_TETTH Putative uncharacterized protein OS=Tetra... 37 0.65
tr|A0BQN4|A0BQN4_PARTE Chromosome undetermined scaffold_121, who... 37 0.65
tr|A0BLE6|A0BLE6_PARTE Chromosome undetermined scaffold_114, who... 37 0.65
tr|Q22S45|Q22S45_TETTH Insect antifreeze protein OS=Tetrahymena ... 36 0.85
tr|Q22P15|Q22P15_TETTH Putative uncharacterized protein OS=Tetra... 36 0.85
tr|Q23VY5|Q23VY5_TETTH Bowman-Birk serine protease inhibitor fam... 36 1.1

>tr|A9S5J7|A9S5J7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_124381 PE=4 SV=1
Length = 292

Score = 119 bits (298), Expect = 8e-26
Identities = 51/88 (57%), Positives = 60/88 (68%), Gaps = 2/88 (2%)
Frame = +2

Query: 26 DDDRAIDVEECPMCTSVRLVYDCTREKCQQKKGVGTYDCRACILCIVRCEACGRCI--TD 199
D+DRAID+E CP C RLV+DCTR CQ+++ Y CR C LCI RCE CG CI T+
Sbjct: 171 DEDRAIDIEICPKCGGARLVFDCTRPTCQERRNNPLYQCRGCYLCIARCEECGMCIDTTE 230

Query: 200 NNYEETFSLDVLCSCCWLGSPKCAECNR 283
ETF L+ LC CWL SPKC+ECNR
Sbjct: 231 EENGETFCLESLCQSCWLQSPKCSECNR 258


>tr|A7QBT8|A7QBT8_VITVI Chromosome chr1 scaffold_75, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00035104001
PE=4 SV=1
Length = 458

Score = 109 bits (272), Expect = 8e-23
Identities = 48/89 (53%), Positives = 59/89 (66%)
Frame = +2

Query: 8 HYSMFQDDDRAIDVEECPMCTSVRLVYDCTREKCQQKKGVGTYDCRACILCIVRCEACGR 187
++ + DDDRAID+E CP C ++RLVYDC + CQ K+ CRAC LCI RC CGR
Sbjct: 363 NFYLLGDDDRAIDIETCPRCQNLRLVYDCPADGCQVKENAAQV-CRACTLCIARCVQCGR 421

Query: 188 CITDNNYEETFSLDVLCSCCWLGSPKCAE 274
CI D YEETF L+ LCS C+ P+C E
Sbjct: 422 CINDGEYEETFCLEWLCSDCFKQQPQCQE 450


>tr|Q7EY67|Q7EY67_ORYSJ F-box protein family-like protein OS=Oryza
sativa subsp. japonica GN=OSJNBb0032E15.123 PE=4 SV=1
Length = 889

Score = 103 bits (256), Expect = 6e-21
Identities = 47/95 (49%), Positives = 58/95 (61%), Gaps = 2/95 (2%)
Frame = +2

Query: 8 HYSMFQDDDRAIDVEECPMCTSVRLVYDCTREKCQQKKGVGTYDCRACILCIVRCEACGR 187
H + +D+R IDV+ CPMCT+VRLV+DCTR+ C++K CR C C+ RCE CG
Sbjct: 759 HEVLNTNDERRIDVDVCPMCTNVRLVFDCTRDGCRRKDSWA--QCRGCFFCVARCETCGG 816

Query: 188 CITDNNYEET--FSLDVLCSCCWLGSPKCAECNRP 286
CI ET D LC CWL PKC+ CNRP
Sbjct: 817 CIDLEELSETELACSDFLCMECWLPLPKCSTCNRP 851


>tr|Q0J5K5|Q0J5K5_ORYSJ Os08g0428100 protein OS=Oryza sativa subsp.
japonica GN=Os08g0428100 PE=4 SV=1
Length = 338

Score = 103 bits (256), Expect = 6e-21
Identities = 47/95 (49%), Positives = 58/95 (61%), Gaps = 2/95 (2%)
Frame = +2

Query: 8 HYSMFQDDDRAIDVEECPMCTSVRLVYDCTREKCQQKKGVGTYDCRACILCIVRCEACGR 187
H + +D+R IDV+ CPMCT+VRLV+DCTR+ C++K CR C C+ RCE CG
Sbjct: 214 HEVLNTNDERRIDVDVCPMCTNVRLVFDCTRDGCRRKDSWA--QCRGCFFCVARCETCGG 271

Query: 188 CITDNNYEET--FSLDVLCSCCWLGSPKCAECNRP 286
CI ET D LC CWL PKC+ CNRP
Sbjct: 272 CIDLEELSETELACSDFLCMECWLPLPKCSTCNRP 306


>tr|A7P3T3|A7P3T3_VITVI Chromosome chr1 scaffold_5, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00030569001
PE=4 SV=1
Length = 309

Score = 103 bits (256), Expect = 6e-21
Identities = 44/88 (50%), Positives = 54/88 (61%)
Frame = +2

Query: 23 QDDDRAIDVEECPMCTSVRLVYDCTREKCQQKKGVGTYDCRACILCIVRCEACGRCITDN 202
++ R ID+E CP C VR+V+DC RE C++K+ +CR C CI RCE CG+CI
Sbjct: 190 EESYRPIDLEICPRCNEVRMVFDCPRETCKKKRERAMAECRGCYFCIPRCEECGKCIEVE 249

Query: 203 NYEETFSLDVLCSCCWLGSPKCAECNRP 286
E DVLCS CWL PKC CNRP
Sbjct: 250 EPGEVVCADVLCSDCWLQLPKCNFCNRP 277


>tr|A3BTB7|A3BTB7_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_026289 PE=4 SV=1
Length = 214

Score = 103 bits (256), Expect = 6e-21
Identities = 47/95 (49%), Positives = 58/95 (61%), Gaps = 2/95 (2%)
Frame = +2

Query: 8 HYSMFQDDDRAIDVEECPMCTSVRLVYDCTREKCQQKKGVGTYDCRACILCIVRCEACGR 187
H + +D+R IDV+ CPMCT+VRLV+DCTR+ C++K CR C C+ RCE CG
Sbjct: 90 HEVLNTNDERRIDVDVCPMCTNVRLVFDCTRDGCRRKDSWA--QCRGCFFCVARCETCGG 147

Query: 188 CITDNNYEET--FSLDVLCSCCWLGSPKCAECNRP 286
CI ET D LC CWL PKC+ CNRP
Sbjct: 148 CIDLEELSETELACSDFLCMECWLPLPKCSTCNRP 182


>tr|A7PLU8|A7PLU8_VITVI Chromosome chr14 scaffold_21, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020573001
PE=4 SV=1
Length = 480

Score = 102 bits (255), Expect = 7e-21
Identities = 49/83 (59%), Positives = 53/83 (63%)
Frame = +2

Query: 26 DDDRAIDVEECPMCTSVRLVYDCTREKCQQKKGVGTYDCRACILCIVRCEACGRCITDNN 205
DDDRAID+E CP C VRLVYDC E CQ K CRAC LCI RC CGRCI D +
Sbjct: 372 DDDRAIDIEVCPRCQKVRLVYDCPSESCQGKHQSAQL-CRACTLCIARCFHCGRCINDCD 430

Query: 206 YEETFSLDVLCSCCWLGSPKCAE 274
YEETF LD+LC C+ C E
Sbjct: 431 YEETFCLDLLCLDCFKQLLNCQE 453


>tr|Q9LU91|Q9LU91_ARATH Gb|AAD12709.1 (At3g26000)
(AT3g26000/MPE11_15) OS=Arabidopsis thaliana
GN=At3g26000 PE=1 SV=1
Length = 453

Score = 102 bits (253), Expect = 1e-20
Identities = 45/80 (56%), Positives = 56/80 (70%)
Frame = +2

Query: 26 DDDRAIDVEECPMCTSVRLVYDCTREKCQQKKGVGTYDCRACILCIVRCEACGRCITDNN 205
DDDRA+D+E CP C + +LVYDC E C+ KK G+ +CRAC LCI RC CGRCI D
Sbjct: 372 DDDRALDIEMCPKCQNFKLVYDCPAEDCKGKKK-GSEECRACSLCIQRCYHCGRCIIDTE 430

Query: 206 YEETFSLDVLCSCCWLGSPK 265
YEE F L++LC+ C +PK
Sbjct: 431 YEEMFCLELLCAVCSKPTPK 450


>tr|B8BB00|B8BB00_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_29306 PE=4 SV=1
Length = 358

Score = 101 bits (251), Expect = 2e-20
Identities = 46/95 (48%), Positives = 58/95 (61%), Gaps = 2/95 (2%)
Frame = +2

Query: 8 HYSMFQDDDRAIDVEECPMCTSVRLVYDCTREKCQQKKGVGTYDCRACILCIVRCEACGR 187
H + +D+R IDV+ CP+CT+VRLV+DCTR+ C++K CR C C+ RCE CG
Sbjct: 215 HEVLNTNDERHIDVDVCPICTNVRLVFDCTRDGCRRKD--SRAQCRGCFFCVARCETCGG 272

Query: 188 CITDNNYEET--FSLDVLCSCCWLGSPKCAECNRP 286
CI ET D LC CWL PKC+ CNRP
Sbjct: 273 CIDLEELSETELACSDFLCMECWLPLPKCSTCNRP 307


>tr|B4FSX1|B4FSX1_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 300

Score = 100 bits (250), Expect = 3e-20
Identities = 48/102 (47%), Positives = 58/102 (56%), Gaps = 2/102 (1%)
Frame = +2

Query: 8 HYSMFQDDDRAIDVEECPMCTSVRLVYDCTREKCQQKKGVGTYDCRACILCIVRCEACGR 187
H + DD R IDV+ CP+C +VRLV+DCTR+ C++ K G CR C C+ RCE CG
Sbjct: 170 HEVLNTDDGRPIDVDLCPLCRNVRLVFDCTRKNCREVKD-GRSRCRGCFFCVARCETCGG 228

Query: 188 CITDNNYEET--FSLDVLCSCCWLGSPKCAECNRPASECDPN 307
CI E+ D LC CWL PKC CNRP E N
Sbjct: 229 CIDLEELGESGLACSDFLCMDCWLKLPKCCTCNRPYCERHSN 270