BP911441
Clone id YMU001_000005_A07
Library
Length 609
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000005_A07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTTCGGGCGATTTCGATCCACTGACCTCCGTTCTGTCAGCATTTCAAATAGCACTACTCC
AAAGCTCCACACATCACTTTTTGATGTAAGATGTCCCGTCTGTACATACTCTGGAGCTGC
ATAACCTATGGTACCAACTACCGAAGTTGAAACATGGGTTGCCCCCATCTCTGGGCCCTG
TCTAGCCAGCCCAAAGTCTGATAATTTTGGAGTGAAATCCTCATCTAACAAGACATTTGA
GGTTTTGAAATCACGAAATATAACCTGCAGTTCTGAATACCTTCAATTTCTTGATGCAAG
TAAGCCAAACCACGAGCAGCGCCGAGCATGATTTGAATCCGTTGTCGCCAAGACAGAACA
GATTGGCTTTTTGAGAAAAGATAGCCCTCAAGGCTTCCCCTGGCAATAAATTCATACACA
AGTAGGCGTTGGATACCCCTTTCATCATCTTCTGCACAATAGCCCACCAGCTTCACGAGG
TTTGGATGCTCCACCAGCCCCAAGAAGCGAACCTCTGCCAGCCACTCCTTGTGTCCCTGT
TGCCCATTCCGGTTCAAGAGCTTGACAGCAACTTCCTTTGAAGATTGAGTACCTGCAGGT
AATATCTCA
■■Homology search results ■■ -
sp_hit_id P46573
Definition sp|P46573|APK1B_ARATH Protein kinase APK1B, chloroplastic OS=Arabidopsis thaliana
Align length 91
Score (bit) 128.0
E-value 3.0e-57
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911441|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_A07.
(609 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P46573|APK1B_ARATH Protein kinase APK1B, chloroplastic OS=Ara... 128 3e-57
sp|Q06548|APK1A_ARATH Protein kinase APK1A, chloroplastic OS=Ara... 130 2e-56
sp|P43293|NAK_ARATH Probable serine/threonine-protein kinase NAK... 123 6e-56
sp|O48814|BIK1_ARATH Serine/threonine-protein kinase BIK1 OS=Ara... 115 3e-51
sp|Q9FE20|PBS1_ARATH Serine/threonine-protein kinase PBS1 OS=Ara... 116 9e-49
sp|Q9LQQ8|RLCK7_ARATH Probable serine/threonine-protein kinase R... 114 6e-48
sp|P27450|CX32_ARATH Probable serine/threonine-protein kinase Cx... 106 1e-46
sp|Q9LX66|Y3290_ARATH Probable receptor-like protein kinase At3g... 102 1e-39
sp|Q9CAL2|CRK3_ARATH Cysteine-rich receptor-like protein kinase ... 104 3e-38
sp|Q3EDL4|Y1154_ARATH Putative serine/threonine-protein kinase A... 92 2e-37
sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase ... 90 3e-37
sp|Q9FNE1|CRK42_ARATH Cysteine-rich receptor-like protein kinase... 91 4e-36
sp|Q66GN2|LRKA3_ARATH Lectin-domain containing receptor kinase A... 87 6e-36
sp|Q8L4H4|NORK_MEDTR Nodulation receptor kinase OS=Medicago trun... 88 2e-35
sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis t... 96 4e-35
sp|Q8LKZ1|NORK_PEA Nodulation receptor kinase OS=Pisum sativum G... 87 4e-35
sp|Q9M020|LRKA2_ARATH Lectin-domain containing receptor kinase A... 84 5e-35
sp|Q9XEC7|CRK37_ARATH Cysteine-rich receptor-like protein kinase... 85 9e-35
sp|Q9SYS3|CRK40_ARATH Cysteine-rich receptor-like protein kinase... 84 2e-34
sp|Q9XEC8|CRK38_ARATH Cysteine-rich receptor-like protein kinase... 84 2e-34
sp|Q9SYS7|CRK39_ARATH Putative cysteine-rich receptor-like prote... 84 2e-34
sp|O49564|CRK27_ARATH Cysteine-rich receptor-like protein kinase... 89 2e-34
sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1... 83 3e-34
sp|Q9LDM5|CRK31_ARATH Putative cysteine-rich receptor-like prote... 84 4e-34
sp|Q9T0J1|CRK26_ARATH Cysteine-rich receptor-like protein kinase... 84 6e-34
sp|Q9C5S8|CRK5_ARATH Cysteine-rich receptor-like protein kinase ... 86 6e-34
sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota... 87 1e-33
sp|Q09092|SRK6_BRAOE Putative serine/threonine-protein kinase re... 85 2e-33
sp|O64483|SIRK_ARATH Senescence-induced receptor-like serine/thr... 86 2e-33
sp|O65479|CRK20_ARATH Putative cysteine-rich receptor-like prote... 86 2e-33

>sp|P46573|APK1B_ARATH Protein kinase APK1B, chloroplastic
OS=Arabidopsis thaliana GN=APK1B PE=2 SV=2
Length = 412

Score = 128 bits (322), Expect(2) = 3e-57
Identities = 59/91 (64%), Positives = 76/91 (83%)
Frame = -1

Query: 276 SELQVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQT 97
+E VI+RDFKTSN+LLD ++ KLSDFGLA+ GP +HVST ++GT GYAAPEY+ T
Sbjct: 196 AETSVIYRDFKTSNILLDSEYNAKLSDFGLAKDGPTGDKSHVSTRIMGTYGYAAPEYLAT 255

Query: 96 GHLTSKSDVWSFGVVLFEMLTERRSVDRNRP 4
GHLT+KSDV+S+GVVL E+L+ RR+VD+NRP
Sbjct: 256 GHLTTKSDVYSYGVVLLEVLSGRRAVDKNRP 286



Score = 114 bits (285), Expect(2) = 3e-57
Identities = 56/95 (58%), Positives = 71/95 (74%), Gaps = 2/95 (2%)
Frame = -2

Query: 572 VAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQRLLVYEFIARGS 393
+AVK LN++G QGH+EWLAEV +LG HPNLVKL+GYC ED+ RLLVYEF+ RGS
Sbjct: 104 IAVKKLNQDGWQGHQEWLAEVNYLGQFSHPNLVKLIGYCLEDE----HRLLVYEFMPRGS 159

Query: 392 LEGYLFSKSQ--SVLSWRQRIQIMLGAARGLAYLH 294
LE +LF + LSW R+++ LGAA+GLA+LH
Sbjct: 160 LENHLFRRGSYFQPLSWTLRLKVALGAAKGLAFLH 194


>sp|Q06548|APK1A_ARATH Protein kinase APK1A, chloroplastic
OS=Arabidopsis thaliana GN=APK1A PE=2 SV=1
Length = 410

Score = 130 bits (327), Expect(2) = 2e-56
Identities = 62/91 (68%), Positives = 77/91 (84%)
Frame = -1

Query: 276 SELQVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQT 97
SE +VI+RDFKTSN+LLD ++ KLSDFGLA+ GP +HVST V+GT GYAAPEY+ T
Sbjct: 195 SETRVIYRDFKTSNILLDSEYNAKLSDFGLAKDGPIGDKSHVSTRVMGTHGYAAPEYLAT 254

Query: 96 GHLTSKSDVWSFGVVLFEMLTERRSVDRNRP 4
GHLT+KSDV+SFGVVL E+L+ RR+VD+NRP
Sbjct: 255 GHLTTKSDVYSFGVVLLELLSGRRAVDKNRP 285



Score = 109 bits (272), Expect(2) = 2e-56
Identities = 54/95 (56%), Positives = 71/95 (74%), Gaps = 2/95 (2%)
Frame = -2

Query: 572 VAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQRLLVYEFIARGS 393
+AVK LN++G QGH+EWLAEV +LG H +LVKL+GYC ED+ RLLVYEF+ RGS
Sbjct: 103 IAVKKLNQDGWQGHQEWLAEVNYLGQFSHRHLVKLIGYCLEDE----HRLLVYEFMPRGS 158

Query: 392 LEGYLFSKSQ--SVLSWRQRIQIMLGAARGLAYLH 294
LE +LF + LSW+ R+++ LGAA+GLA+LH
Sbjct: 159 LENHLFRRGLYFQPLSWKLRLKVALGAAKGLAFLH 193


>sp|P43293|NAK_ARATH Probable serine/threonine-protein kinase NAK
OS=Arabidopsis thaliana GN=NAK PE=2 SV=2
Length = 389

Score = 123 bits (308), Expect(2) = 6e-56
Identities = 58/88 (65%), Positives = 73/88 (82%)
Frame = -1

Query: 267 QVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTGHL 88
QVI+RDFK SN+LLD ++ KLSDFGLAR GP +HVST V+GT GYAAPEY+ TGHL
Sbjct: 198 QVIYRDFKASNILLDSNYNAKLSDFGLARDGPMGDNSHVSTRVMGTQGYAAPEYLATGHL 257

Query: 87 TSKSDVWSFGVVLFEMLTERRSVDRNRP 4
+ KSDV+SFGVVL E+L+ RR++D+N+P
Sbjct: 258 SVKSDVYSFGVVLLELLSGRRAIDKNQP 285



Score = 115 bits (287), Expect(2) = 6e-56
Identities = 55/95 (57%), Positives = 72/95 (75%), Gaps = 2/95 (2%)
Frame = -2

Query: 572 VAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQRLLVYEFIARGS 393
+AVK LN+ G QGH+EWLAE+ +LG ++HPNLVKL+GYC E++ RLLVYEF+ RGS
Sbjct: 103 IAVKRLNQEGFQGHREWLAEINYLGQLDHPNLVKLIGYCLEEE----HRLLVYEFMTRGS 158

Query: 392 LEGYLFSKS--QSVLSWRQRIQIMLGAARGLAYLH 294
LE +LF + LSW R+++ LGAARGLA+LH
Sbjct: 159 LENHLFRRGTFYQPLSWNTRVRMALGAARGLAFLH 193


>sp|O48814|BIK1_ARATH Serine/threonine-protein kinase BIK1
OS=Arabidopsis thaliana GN=BIK1 PE=1 SV=1
Length = 395

Score = 115 bits (289), Expect(2) = 3e-51
Identities = 53/89 (59%), Positives = 72/89 (80%)
Frame = -1

Query: 270 LQVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTGH 91
++VI+RD K SN+LLD D+ KLSDFGLAR GP ++VST V+GT GYAAPEY+ +GH
Sbjct: 196 VKVIYRDIKASNILLDADYNAKLSDFGLARDGPMGDLSYVSTRVMGTYGYAAPEYMSSGH 255

Query: 90 LTSKSDVWSFGVVLFEMLTERRSVDRNRP 4
L ++SDV+SFGV+L E+L+ +R++D NRP
Sbjct: 256 LNARSDVYSFGVLLLEILSGKRALDHNRP 284



Score = 106 bits (265), Expect(2) = 3e-51
Identities = 51/97 (52%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
Frame = -2

Query: 572 VAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQRLLVYEFIARGS 393
+AVK LN+ G QGH+EWL E+ +LG + HPNLVKL+GYC ED+ RLLVYEF+ +GS
Sbjct: 102 IAVKKLNQEGFQGHREWLTEINYLGQLSHPNLVKLIGYCLEDE----HRLLVYEFMQKGS 157

Query: 392 LEGYLFSKSQ--SVLSWRQRIQIMLGAARGLAYLHQE 288
LE +LF + L W R+ + L AA+GLA+LH +
Sbjct: 158 LENHLFRRGAYFKPLPWFLRVNVALDAAKGLAFLHSD 194


>sp|Q9FE20|PBS1_ARATH Serine/threonine-protein kinase PBS1
OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1
Length = 456

Score = 116 bits (291), Expect(2) = 9e-49
Identities = 55/87 (63%), Positives = 67/87 (77%)
Frame = -1

Query: 264 VIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTGHLT 85
VI+RDFK+SN+LLDE F PKLSDFGLA+ GP +HVST V+GT GY APEY TG LT
Sbjct: 209 VIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLT 268

Query: 84 SKSDVWSFGVVLFEMLTERRSVDRNRP 4
KSDV+SFGVV E++T R+++D P
Sbjct: 269 VKSDVYSFGVVFLELITGRKAIDSEMP 295



Score = 97.8 bits (242), Expect(2) = 9e-49
Identities = 51/97 (52%), Positives = 66/97 (68%), Gaps = 2/97 (2%)
Frame = -2

Query: 572 VAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQRLLVYEFIARGS 393
VAVK L+RNG QG++E+L EV L L+ HPNLV L+GYCA+ D QRLLVYEF+ GS
Sbjct: 112 VAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGD----QRLLVYEFMPLGS 167

Query: 392 LEGYL--FSKSQSVLSWRQRIQIMLGAARGLAYLHQE 288
LE +L + L W R++I GAA+GL +LH +
Sbjct: 168 LEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFLHDK 204


>sp|Q9LQQ8|RLCK7_ARATH Probable serine/threonine-protein kinase
RLCKVII OS=Arabidopsis thaliana GN=At1g07870 PE=2 SV=1
Length = 423

Score = 114 bits (284), Expect(2) = 6e-48
Identities = 52/88 (59%), Positives = 67/88 (76%)
Frame = -1

Query: 264 VIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTGHLT 85
VI+RD K SN+LL ED+ PKLSDFGLA+ GP THVST V+GT GY AP+Y TG LT
Sbjct: 226 VIYRDLKCSNILLGEDYQPKLSDFGLAKVGPSGDKTHVSTRVMGTYGYCAPDYAMTGQLT 285

Query: 84 SKSDVWSFGVVLFEMLTERRSVDRNRPK 1
KSD++SFGVVL E++T R+++D + +
Sbjct: 286 FKSDIYSFGVVLLELITGRKAIDNTKTR 313



Score = 97.8 bits (242), Expect(2) = 6e-48
Identities = 51/98 (52%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
Frame = -2

Query: 572 VAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQRLLVYEFIARGS 393
VA+K L+RNG QG +E++ EV L L +HPNLVKL+G+CAE D QRLLVYE++ +GS
Sbjct: 129 VAIKQLDRNGVQGIREFVVEVLTLSLADHPNLVKLIGFCAEGD----QRLLVYEYMPQGS 184

Query: 392 LEGYL--FSKSQSVLSWRQRIQIMLGAARGLAYLHQEI 285
LE +L + L W R++I GAARGL YLH +
Sbjct: 185 LEDHLHVLPSGKKPLDWNTRMKIAAGAARGLEYLHDRM 222


>sp|P27450|CX32_ARATH Probable serine/threonine-protein kinase Cx32,
chloroplastic OS=Arabidopsis thaliana GN=At4g35600 PE=1
SV=2
Length = 419

Score = 106 bits (265), Expect(2) = 1e-46
Identities = 50/89 (56%), Positives = 68/89 (76%)
Frame = -1

Query: 267 QVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTGHL 88
+VI+RDFK SN+LLD ++ KLSDFGLA+ GP +HV+T ++GT GYAAPEY+ TGHL
Sbjct: 213 EVIYRDFKASNILLDSNYDAKLSDFGLAKLGPADEKSHVTTRIMGTYGYAAPEYMATGHL 272

Query: 87 TSKSDVWSFGVVLFEMLTERRSVDRNRPK 1
KSDV++FGVVL E++T + + RP+
Sbjct: 273 YVKSDVFAFGVVLLEIMTGLTAHNTKRPR 301



Score = 100 bits (250), Expect(2) = 1e-46
Identities = 53/104 (50%), Positives = 69/104 (66%)
Frame = -2

Query: 605 ILPAGTQSSKEVAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQR 426
+ P+ S VA+K LN QG EW +EV FLG++ H NLVKL+GYC ED E
Sbjct: 110 LAPSRVGSGMIVAIKRLNSESVQGFAEWRSEVNFLGMLSHRNLVKLLGYCREDKE----L 165

Query: 425 LLVYEFIARGSLEGYLFSKSQSVLSWRQRIQIMLGAARGLAYLH 294
LLVYEF+ +GSLE +LF ++ W RI+I++GAARGLA+LH
Sbjct: 166 LLVYEFMPKGSLESHLFRRNDP-FPWDLRIKIVIGAARGLAFLH 208


>sp|Q9LX66|Y3290_ARATH Probable receptor-like protein kinase
At3g46290 OS=Arabidopsis thaliana GN=At3g46290 PE=1 SV=1
Length = 830

Score = 102 bits (255), Expect(2) = 1e-39
Identities = 49/88 (55%), Positives = 65/88 (73%)
Frame = -1

Query: 264 VIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTGHLT 85
VI RD K++N+LLDE+F K++DFGL++ GPE+ THVST+V G+ GY PEY + LT
Sbjct: 605 VIHRDVKSANILLDENFMAKVADFGLSKTGPELDQTHVSTAVKGSFGYLDPEYFRRQQLT 664

Query: 84 SKSDVWSFGVVLFEMLTERRSVDRNRPK 1
KSDV+SFGVVLFE+L R +D P+
Sbjct: 665 DKSDVYSFGVVLFEVLCARPVIDPTLPR 692



Score = 81.3 bits (199), Expect(2) = 1e-39
Identities = 39/94 (41%), Positives = 60/94 (63%)
Frame = -2

Query: 575 EVAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQRLLVYEFIARG 396
+VAVK N QQG E+ E+ L H +LV L+GYC E++E +L+YE++ G
Sbjct: 509 KVAVKRGNPKSQQGLAEFRTEIEMLSQFRHRHLVSLIGYCDENNEM----ILIYEYMENG 564

Query: 395 SLEGYLFSKSQSVLSWRQRIQIMLGAARGLAYLH 294
+++ +L+ L+W+QR++I +GAARGL YLH
Sbjct: 565 TVKSHLYGSGLPSLTWKQRLEICIGAARGLHYLH 598


>sp|Q9CAL2|CRK3_ARATH Cysteine-rich receptor-like protein kinase 3
OS=Arabidopsis thaliana GN=CRK3 PE=2 SV=1
Length = 646

Score = 104 bits (260), Expect(2) = 3e-38
Identities = 48/85 (56%), Positives = 68/85 (80%)
Frame = -1

Query: 276 SELQVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQT 97
S L++I RD K SN+LL++DFTP+++DFGLAR PE TH+ST++ GT+GY APEYV
Sbjct: 440 SNLRIIHRDIKLSNILLEDDFTPRIADFGLARLFPE-DKTHISTAIAGTLGYMAPEYVVR 498

Query: 96 GHLTSKSDVWSFGVVLFEMLTERRS 22
G LT K+DV+SFGV++ E++T +R+
Sbjct: 499 GKLTEKADVYSFGVLMIEVITGKRN 523



Score = 74.3 bits (181), Expect(2) = 3e-38
Identities = 45/100 (45%), Positives = 59/100 (59%), Gaps = 1/100 (1%)
Frame = -2

Query: 584 SSKEVAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQRLLVYEFI 405
+ K VAVK L N +Q + EV + V+H NLVKL+G G + LLVYE+I
Sbjct: 344 NGKTVAVKRLFFNTKQWVDHFFNEVNLISQVDHKNLVKLLGCSIT----GPESLLVYEYI 399

Query: 404 ARGSLEGYLF-SKSQSVLSWRQRIQIMLGAARGLAYLHQE 288
A SL YLF K L+W +R +I+LG A G+AYLH+E
Sbjct: 400 ANQSLHDYLFVRKDVQPLNWAKRFKIILGTAEGMAYLHEE 439


>sp|Q3EDL4|Y1154_ARATH Putative serine/threonine-protein kinase
At1g01540 OS=Arabidopsis thaliana GN=At1g01540 PE=1 SV=2
Length = 472

Score = 92.4 bits (228), Expect(2) = 2e-37
Identities = 46/92 (50%), Positives = 67/92 (72%), Gaps = 1/92 (1%)
Frame = -1

Query: 273 ELQVIFRDFKTSNVLLDEDFTPKLSDFGLARQ-GPEMGATHVSTSVVGTIGYAAPEYVQT 97
E +V+ RD K+SN+LLD + K+SDFGLA+ G E +++V+T V+GT GY APEY T
Sbjct: 273 EPKVVHRDIKSSNILLDRQWNAKVSDFGLAKLLGSE--SSYVTTRVMGTFGYVAPEYACT 330

Query: 96 GHLTSKSDVWSFGVVLFEMLTERRSVDRNRPK 1
G L KSD++SFG+++ E++T R VD +RP+
Sbjct: 331 GMLNEKSDIYSFGILIMEIITGRNPVDYSRPQ 362



Score = 84.0 bits (206), Expect(2) = 2e-37
Identities = 50/110 (45%), Positives = 67/110 (60%), Gaps = 2/110 (1%)
Frame = -2

Query: 605 ILPAGTQSSKEVAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQR 426
IL GT+ VAVK L N Q KE+ EV +G V H NLV+L+GYC E G R
Sbjct: 172 ILTDGTK----VAVKNLLNNRGQAEKEFKVEVEVIGRVRHKNLVRLLGYCVE----GAYR 223

Query: 425 LLVYEFIARGSLEGYLFSK--SQSVLSWRQRIQIMLGAARGLAYLHQEIE 282
+LVY+F+ G+LE ++ S L+W R+ I+LG A+GLAYLH+ +E
Sbjct: 224 MLVYDFVDNGNLEQWIHGDVGDVSPLTWDIRMNIILGMAKGLAYLHEGLE 273


tr_hit_id A7PK53
Definition tr|A7PK53|A7PK53_VITVI Chromosome chr15 scaffold_19, whole genome shotgun sequence OS=Vitis vinifera
Align length 91
Score (bit) 149.0
E-value 4.0e-71
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911441|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_A07.
(609 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PK53|A7PK53_VITVI Chromosome chr15 scaffold_19, whole genom... 149 4e-71
tr|A7UGD8|A7UGD8_MALDO Ser/thr protein kinase OS=Malus domestica... 149 6e-70
tr|Q6H3Z1|Q6H3Z1_ORYSJ Os02g0650500 protein OS=Oryza sativa subs... 150 2e-69
tr|A2X7U8|A2X7U8_ORYSI Putative uncharacterized protein OS=Oryza... 150 2e-69
tr|A7PCH6|A7PCH6_VITVI Chromosome chr2 scaffold_11, whole genome... 148 3e-69
tr|B6STX9|B6STX9_MAIZE Serine/threonine-protein kinase NAK OS=Ze... 147 5e-69
tr|Q6K720|Q6K720_ORYSJ Os02g0819600 protein OS=Oryza sativa subs... 143 1e-68
tr|B8AF73|B8AF73_ORYSI Putative uncharacterized protein OS=Oryza... 143 1e-68
tr|A9TDK5|A9TDK5_PHYPA Predicted protein (Fragment) OS=Physcomit... 149 1e-68
tr|B8A2T3|B8A2T3_MAIZE Putative uncharacterized protein OS=Zea m... 144 3e-68
tr|B4FLU1|B4FLU1_MAIZE Putative uncharacterized protein OS=Zea m... 147 4e-68
tr|B6SRI6|B6SRI6_MAIZE Protein kinase APK1A OS=Zea mays PE=2 SV=1 144 7e-68
tr|A9RSP4|A9RSP4_PHYPA Predicted protein (Fragment) OS=Physcomit... 147 9e-68
tr|B6SKD8|B6SKD8_MAIZE Serine/threonine-protein kinase NAK OS=Ze... 144 3e-67
tr|Q9SF86|Q9SF86_ARATH Putative uncharacterized protein F8A24.12... 145 1e-66
tr|O81064|O81064_ARATH Putative uncharacterized protein At2g2894... 147 2e-66
tr|Q5Z9Q3|Q5Z9Q3_ORYSJ Os06g0714900 protein OS=Oryza sativa subs... 147 2e-66
tr|A3BFD8|A3BFD8_ORYSJ Putative uncharacterized protein OS=Oryza... 147 2e-66
tr|A2YGZ3|A2YGZ3_ORYSI Putative uncharacterized protein OS=Oryza... 147 2e-66
tr|Q7XUI8|Q7XUI8_ORYSJ Os04g0543000 protein OS=Oryza sativa subs... 147 4e-66
tr|B4FF95|B4FF95_MAIZE Putative uncharacterized protein OS=Zea m... 145 4e-66
tr|Q69SG8|Q69SG8_ORYSJ Os09g0533600 protein OS=Oryza sativa subs... 140 8e-66
tr|A2Z3F6|A2Z3F6_ORYSI Putative uncharacterized protein OS=Oryza... 140 8e-66
tr|Q1W203|Q1W203_TOBAC NAK-type protein kinase OS=Nicotiana taba... 139 1e-65
tr|A9SE44|A9SE44_PHYPA Predicted protein (Fragment) OS=Physcomit... 143 2e-65
tr|B7FK13|B7FK13_MEDTR Putative uncharacterized protein (Fragmen... 140 4e-65
tr|A3ACR2|A3ACR2_ORYSJ Putative uncharacterized protein OS=Oryza... 143 9e-65
tr|A3BJZ6|A3BJZ6_ORYSJ Putative uncharacterized protein OS=Oryza... 139 9e-65
tr|A7PT59|A7PT59_VITVI Chromosome chr8 scaffold_29, whole genome... 143 9e-65
tr|Q84VX8|Q84VX8_ARATH At2g39110 OS=Arabidopsis thaliana PE=2 SV=1 146 1e-64

>tr|A7PK53|A7PK53_VITVI Chromosome chr15 scaffold_19, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019023001
PE=4 SV=1
Length = 427

Score = 149 bits (376), Expect(2) = 4e-71
Identities = 68/91 (74%), Positives = 83/91 (91%)
Frame = -1

Query: 273 ELQVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTG 94
E+QVI+RDFK+SNVLLD+DF PKLSDFGLAR+GP G THVST+ VGT GYAAP+Y++TG
Sbjct: 202 EVQVIYRDFKSSNVLLDKDFNPKLSDFGLAREGPADGFTHVSTAAVGTFGYAAPDYIETG 261

Query: 93 HLTSKSDVWSFGVVLFEMLTERRSVDRNRPK 1
HLT+KSDVWSFGVVL+E+LT RRS++RN P+
Sbjct: 262 HLTTKSDVWSFGVVLYEILTGRRSMERNHPR 292



Score = 143 bits (360), Expect(2) = 4e-71
Identities = 70/109 (64%), Positives = 88/109 (80%), Gaps = 1/109 (0%)
Frame = -2

Query: 605 ILPA-GTQSSKEVAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQ 429
I PA G S EVA+K LN +G QGHK+W+AEV+FLG+VEHPNLVKL+GYCA D ERGIQ
Sbjct: 94 IKPADGKGDSFEVAIKRLNPDGVQGHKQWVAEVQFLGIVEHPNLVKLIGYCAVDGERGIQ 153

Query: 428 RLLVYEFIARGSLEGYLFSKSQSVLSWRQRIQIMLGAARGLAYLHQEIE 282
RLLVYE++ SLE +LF+K+ L W+ R+Q +LGAA+GLAYLH+E+E
Sbjct: 154 RLLVYEYMPNKSLEDHLFNKAIPALPWQTRLQTVLGAAQGLAYLHEELE 202


>tr|A7UGD8|A7UGD8_MALDO Ser/thr protein kinase OS=Malus domestica
GN=AFSK PE=4 SV=1
Length = 429

Score = 149 bits (377), Expect(2) = 6e-70
Identities = 68/91 (74%), Positives = 85/91 (93%)
Frame = -1

Query: 273 ELQVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTG 94
E+QVI+RDFK +NVLLD++F PKLSDFGLAR+GP +G THVST+VVGT GYAAP+Y++TG
Sbjct: 204 EVQVIYRDFKCANVLLDDNFKPKLSDFGLAREGPMVGHTHVSTAVVGTYGYAAPDYIETG 263

Query: 93 HLTSKSDVWSFGVVLFEMLTERRSVDRNRPK 1
HLT+KSDVWSFGVVL+E+LT RRS++RNRP+
Sbjct: 264 HLTAKSDVWSFGVVLYEILTGRRSLERNRPR 294



Score = 139 bits (349), Expect(2) = 6e-70
Identities = 65/97 (67%), Positives = 80/97 (82%)
Frame = -2

Query: 572 VAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQRLLVYEFIARGS 393
VA+K LN +G QGHK+W+AEV+FL +VEHPNLVKL+GYCA D ERGIQRLLVYEF+ S
Sbjct: 108 VAIKKLNNDGLQGHKQWVAEVQFLSVVEHPNLVKLIGYCAVDGERGIQRLLVYEFMPNRS 167

Query: 392 LEGYLFSKSQSVLSWRQRIQIMLGAARGLAYLHQEIE 282
LE +LF+K S + W R+QI+LGAA+GLAYLHQ +E
Sbjct: 168 LEDHLFNKVYSTVPWETRLQIILGAAQGLAYLHQGLE 204


>tr|Q6H3Z1|Q6H3Z1_ORYSJ Os02g0650500 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0012J10.12 PE=2 SV=1
Length = 465

Score = 150 bits (378), Expect(2) = 2e-69
Identities = 70/91 (76%), Positives = 83/91 (91%)
Frame = -1

Query: 273 ELQVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTG 94
E+QVI+RDFK SNVLLDE+F PKLSDFGLAR+GP THVST+V+GT GYAAP+YV+TG
Sbjct: 238 EVQVIYRDFKASNVLLDEEFRPKLSDFGLAREGPTADNTHVSTAVMGTYGYAAPDYVETG 297

Query: 93 HLTSKSDVWSFGVVLFEMLTERRSVDRNRPK 1
HLT+KSDVWSFGVVL+E+LT RRS++RNRPK
Sbjct: 298 HLTNKSDVWSFGVVLYEILTGRRSMERNRPK 328



Score = 137 bits (344), Expect(2) = 2e-69
Identities = 64/107 (59%), Positives = 81/107 (75%)
Frame = -2

Query: 602 LPAGTQSSKEVAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQRL 423
LP G EVA+K LN N +QGHK+WL EV+FLG+VEHPNLVKL+GYCA ERG QRL
Sbjct: 132 LPGGPAGGTEVAIKKLNPNSRQGHKQWLTEVQFLGVVEHPNLVKLIGYCAAQSERGPQRL 191

Query: 422 LVYEFIARGSLEGYLFSKSQSVLSWRQRIQIMLGAARGLAYLHQEIE 282
LVYEF++ +L+ +LF+K+ VL W R++I LGAA GL YLH+ +E
Sbjct: 192 LVYEFMSNKTLDDHLFNKAYPVLPWDIRLKIALGAAEGLLYLHEGLE 238


>tr|A2X7U8|A2X7U8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_08291 PE=4 SV=1
Length = 465

Score = 150 bits (378), Expect(2) = 2e-69
Identities = 70/91 (76%), Positives = 83/91 (91%)
Frame = -1

Query: 273 ELQVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTG 94
E+QVI+RDFK SNVLLDE+F PKLSDFGLAR+GP THVST+V+GT GYAAP+YV+TG
Sbjct: 238 EVQVIYRDFKASNVLLDEEFRPKLSDFGLAREGPTADNTHVSTAVMGTYGYAAPDYVETG 297

Query: 93 HLTSKSDVWSFGVVLFEMLTERRSVDRNRPK 1
HLT+KSDVWSFGVVL+E+LT RRS++RNRPK
Sbjct: 298 HLTNKSDVWSFGVVLYEILTGRRSMERNRPK 328



Score = 137 bits (344), Expect(2) = 2e-69
Identities = 64/107 (59%), Positives = 81/107 (75%)
Frame = -2

Query: 602 LPAGTQSSKEVAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQRL 423
LP G EVA+K LN N +QGHK+WL EV+FLG+VEHPNLVKL+GYCA ERG QRL
Sbjct: 132 LPGGPAGGTEVAIKKLNPNSRQGHKQWLTEVQFLGVVEHPNLVKLIGYCAAQSERGPQRL 191

Query: 422 LVYEFIARGSLEGYLFSKSQSVLSWRQRIQIMLGAARGLAYLHQEIE 282
LVYEF++ +L+ +LF+K+ VL W R++I LGAA GL YLH+ +E
Sbjct: 192 LVYEFMSNKTLDDHLFNKAYPVLPWDIRLKIALGAAEGLLYLHEGLE 238


>tr|A7PCH6|A7PCH6_VITVI Chromosome chr2 scaffold_11, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015865001
PE=4 SV=1
Length = 421

Score = 148 bits (373), Expect(2) = 3e-69
Identities = 69/91 (75%), Positives = 83/91 (91%)
Frame = -1

Query: 273 ELQVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTG 94
E+QVI+RDFK+SNVLLDE+F PKLSDFGLAR+GP THVST+VVGT GYAAPEY++TG
Sbjct: 202 EIQVIYRDFKSSNVLLDENFNPKLSDFGLAREGPTGDHTHVSTAVVGTQGYAAPEYIETG 261

Query: 93 HLTSKSDVWSFGVVLFEMLTERRSVDRNRPK 1
HLT KSD+WSFGVVL+E+LT RR+V+RNRP+
Sbjct: 262 HLTVKSDIWSFGVVLYEILTGRRTVERNRPQ 292



Score = 138 bits (347), Expect(2) = 3e-69
Identities = 67/109 (61%), Positives = 85/109 (77%), Gaps = 1/109 (0%)
Frame = -2

Query: 605 ILPAGTQSSKEV-AVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQ 429
I PA Q + V A+K LN+ G QGHKEWLAEV+FL +V HPNLVKL+GYC+ D ERGIQ
Sbjct: 94 ISPADGQGNPTVVAIKKLNQQGFQGHKEWLAEVQFLSVVSHPNLVKLLGYCSVDGERGIQ 153

Query: 428 RLLVYEFIARGSLEGYLFSKSQSVLSWRQRIQIMLGAARGLAYLHQEIE 282
RLLVYE++ SLE +LF+++ S L W+ R+QI+LGAA GLAYLH+ +E
Sbjct: 154 RLLVYEYMPNKSLENHLFNRTMSTLPWKMRLQIILGAAEGLAYLHEGLE 202


>tr|B6STX9|B6STX9_MAIZE Serine/threonine-protein kinase NAK OS=Zea
mays PE=2 SV=1
Length = 422

Score = 147 bits (372), Expect(2) = 5e-69
Identities = 71/90 (78%), Positives = 81/90 (90%)
Frame = -1

Query: 273 ELQVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTG 94
E+QVI+RDFKTSNVLLD+DF KLSDFGLAR+GP THVST+VVGT GYAAPEY+ TG
Sbjct: 232 EVQVIYRDFKTSNVLLDKDFRAKLSDFGLAREGPTGANTHVSTAVVGTHGYAAPEYMDTG 291

Query: 93 HLTSKSDVWSFGVVLFEMLTERRSVDRNRP 4
HLT+KSDVWSFGVVL+E+LT RRS+DRNRP
Sbjct: 292 HLTAKSDVWSFGVVLYEILTGRRSLDRNRP 321



Score = 137 bits (346), Expect(2) = 5e-69
Identities = 63/97 (64%), Positives = 79/97 (81%)
Frame = -2

Query: 572 VAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQRLLVYEFIARGS 393
VAVK LN+ G QGHK+WLAEV+FLG++EHPNLVKL+GYCA D ERG QRLLVYEF+ S
Sbjct: 136 VAVKKLNQRGMQGHKQWLAEVQFLGVLEHPNLVKLLGYCAVDSERGAQRLLVYEFMPNKS 195

Query: 392 LEGYLFSKSQSVLSWRQRIQIMLGAARGLAYLHQEIE 282
LE +LF ++ +SW R+Q++LGAA GLAYLH+ +E
Sbjct: 196 LEDHLFRRANPPISWNTRLQVILGAAEGLAYLHEGVE 232


>tr|Q6K720|Q6K720_ORYSJ Os02g0819600 protein OS=Oryza sativa subsp.
japonica GN=P0474F11.3 PE=4 SV=1
Length = 427

Score = 143 bits (361), Expect(2) = 1e-68
Identities = 65/91 (71%), Positives = 79/91 (86%)
Frame = -1

Query: 273 ELQVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTG 94
E QVIFRD KTSN+LLDE++ KLSDFGLAR GP G THVST+VVGT+GYAAPEY+QTG
Sbjct: 211 EFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPSEGLTHVSTAVVGTLGYAAPEYMQTG 270

Query: 93 HLTSKSDVWSFGVVLFEMLTERRSVDRNRPK 1
LT+KSD+W +GV+L+E++T RR +DRNRPK
Sbjct: 271 RLTAKSDIWGYGVLLYELITGRRPIDRNRPK 301



Score = 140 bits (354), Expect(2) = 1e-68
Identities = 64/98 (65%), Positives = 80/98 (81%)
Frame = -2

Query: 575 EVAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQRLLVYEFIARG 396
E+AVK LNR G QG KEWL E+ LG+VEHPNLVKL+GYCAEDDERG+QRLLVYE++ G
Sbjct: 114 EIAVKQLNRKGLQGQKEWLTELNVLGIVEHPNLVKLIGYCAEDDERGVQRLLVYEYMPNG 173

Query: 395 SLEGYLFSKSQSVLSWRQRIQIMLGAARGLAYLHQEIE 282
S++ +L S+S S LSW R+++ L AARGL YLH+E+E
Sbjct: 174 SVDDHLSSRSNSTLSWPMRLKVALDAARGLKYLHEEME 211


>tr|B8AF73|B8AF73_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_09473 PE=4 SV=1
Length = 427

Score = 143 bits (361), Expect(2) = 1e-68
Identities = 65/91 (71%), Positives = 79/91 (86%)
Frame = -1

Query: 273 ELQVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTG 94
E QVIFRD KTSN+LLDE++ KLSDFGLAR GP G THVST+VVGT+GYAAPEY+QTG
Sbjct: 211 EFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPSEGLTHVSTAVVGTLGYAAPEYMQTG 270

Query: 93 HLTSKSDVWSFGVVLFEMLTERRSVDRNRPK 1
LT+KSD+W +GV+L+E++T RR +DRNRPK
Sbjct: 271 RLTAKSDIWGYGVLLYELITGRRPIDRNRPK 301



Score = 140 bits (354), Expect(2) = 1e-68
Identities = 64/98 (65%), Positives = 80/98 (81%)
Frame = -2

Query: 575 EVAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQRLLVYEFIARG 396
E+AVK LNR G QG KEWL E+ LG+VEHPNLVKL+GYCAEDDERG+QRLLVYE++ G
Sbjct: 114 EIAVKQLNRKGLQGQKEWLTELNVLGIVEHPNLVKLIGYCAEDDERGVQRLLVYEYMPNG 173

Query: 395 SLEGYLFSKSQSVLSWRQRIQIMLGAARGLAYLHQEIE 282
S++ +L S+S S LSW R+++ L AARGL YLH+E+E
Sbjct: 174 SVDDHLSSRSNSTLSWPMRLKVALDAARGLKYLHEEME 211


>tr|A9TDK5|A9TDK5_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_193977 PE=4 SV=1
Length = 386

Score = 149 bits (376), Expect(2) = 1e-68
Identities = 71/91 (78%), Positives = 81/91 (89%)
Frame = -1

Query: 273 ELQVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTG 94
E QVIFRDFKTSNVLLDEDF PKLSDFGLAR GP+ G ++VST+VVGT GYAAPEYVQTG
Sbjct: 227 EFQVIFRDFKTSNVLLDEDFNPKLSDFGLARLGPQDGDSYVSTAVVGTAGYAAPEYVQTG 286

Query: 93 HLTSKSDVWSFGVVLFEMLTERRSVDRNRPK 1
HLT KSDVWSFG+V+ E+LT RR +D+NRP+
Sbjct: 287 HLTVKSDVWSFGIVMLEVLTGRRVMDKNRPR 317



Score = 134 bits (338), Expect(2) = 1e-68
Identities = 66/105 (62%), Positives = 81/105 (77%), Gaps = 1/105 (0%)
Frame = -2

Query: 593 GTQSSKEVAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCA-EDDERGIQRLLV 417
G +VAVK LN GQQGHKEWLAEV FLGLV+ P+LVKL+GYCA +DDERGIQRLLV
Sbjct: 123 GGDEKIDVAVKQLNSRGQQGHKEWLAEVHFLGLVDSPHLVKLIGYCANDDDERGIQRLLV 182

Query: 416 YEFIARGSLEGYLFSKSQSVLSWRQRIQIMLGAARGLAYLHQEIE 282
YE++ L+ +LF LSW R++I+LGAARGL+YLH+E+E
Sbjct: 183 YEYMQNKGLDDHLFRPGPVPLSWPTRVKIILGAARGLSYLHEELE 227


>tr|B8A2T3|B8A2T3_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 431

Score = 144 bits (364), Expect(2) = 3e-68
Identities = 66/91 (72%), Positives = 80/91 (87%)
Frame = -1

Query: 273 ELQVIFRDFKTSNVLLDEDFTPKLSDFGLARQGPEMGATHVSTSVVGTIGYAAPEYVQTG 94
E QVIFRD KTSN+LLDE++ KLSDFGLAR GP G THVST+VVGT+GYAAPEY+QTG
Sbjct: 211 EFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPAEGLTHVSTAVVGTLGYAAPEYMQTG 270

Query: 93 HLTSKSDVWSFGVVLFEMLTERRSVDRNRPK 1
LT+KSD+WS+GV+L+E++T RR +DRNRPK
Sbjct: 271 RLTAKSDIWSYGVLLYELITGRRPIDRNRPK 301



Score = 138 bits (347), Expect(2) = 3e-68
Identities = 62/98 (63%), Positives = 80/98 (81%)
Frame = -2

Query: 575 EVAVKLLNRNGQQGHKEWLAEVRFLGLVEHPNLVKLVGYCAEDDERGIQRLLVYEFIARG 396
E+AVK LNR G QG KEWL E+ LG+V+HPNLVKL+GYCAEDDERG+QRLLVYE++ G
Sbjct: 114 EIAVKQLNRKGLQGQKEWLTEMNVLGIVDHPNLVKLIGYCAEDDERGVQRLLVYEYMPNG 173

Query: 395 SLEGYLFSKSQSVLSWRQRIQIMLGAARGLAYLHQEIE 282
S++ +L S+S S LSW R+++ L +ARGL YLH+E+E
Sbjct: 174 SVDDHLSSRSTSTLSWPMRLKVALDSARGLKYLHEEME 211