BP911461
Clone id YMU001_000005_C03
Library
Length 447
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000005_C03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTGGAGTATCATGTTTCATGAGCAGCGCATCGACTCCGGTAGCCTTGATCAGCGAAAGAA
AAGTATTGTAGTTCTTGCTCTGGATCAGAATTGCCGTAAAATTGACCGGGGCTGGGGCTG
GTCCTGGAGCTCCGACACCCGTTGGCAACAGAATATTGCTAATGCTGACCACACTGATGT
TGTAAGGGGACTTGTAGATTTCGCTTACAACCGTCGCGGTAAAGACTGAGCTGTCTACCC
TACCGAGCTCGATCGTTGAGCCTTTAATTGTTACATTGAGAAATCCCTCCTTGCCATTGG
CCTGTCCAGAGGTTTGGTAGAGGGTCGTGGAGAGAGAAGTACCATTGGTGATTGCCTTGA
ACTTTGCAATGTCAAAGTAGTCGAGAAGGACATGGTAGCTTATGATATCGTAGAGAGTCG
ATGCAGGGAATGTGGTCCCTCGGACAA
■■Homology search results ■■ -
sp_hit_id Q9SU13
Definition sp|Q9SU13|FLA2_ARATH Fasciclin-like arabinogalactan protein 2 OS=Arabidopsis thaliana
Align length 129
Score (bit) 81.3
E-value 2.0e-15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911461|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_C03.
(447 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SU13|FLA2_ARATH Fasciclin-like arabinogalactan protein 2 OS... 81 2e-15
sp|O22126|FLA8_ARATH Fasciclin-like arabinogalactan protein 8 OS... 77 3e-14
sp|Q9FM65|FLA1_ARATH Fasciclin-like arabinogalactan protein 1 OS... 74 2e-13
sp|Q9LZX4|FLA10_ARATH Fasciclin-like arabinogalactan protein 10 ... 72 8e-13
sp|Q9ZQ23|FLA3_ARATH Fasciclin-like arabinogalactan protein 3 OS... 70 3e-12
sp|Q9LTW9|FLA14_ARATH Fasciclin-like arabinogalactan protein 14 ... 70 3e-12
sp|O49586|FLA5_ARATH Fasciclin-like arabinogalactan protein 5 OS... 65 2e-10
sp|Q9SNC3|FLA4_ARATH Fasciclin-like arabinogalactan protein 4 OS... 60 3e-09
sp|Q8LEE9|FLA12_ARATH Fasciclin-like arabinogalactan protein 12 ... 36 0.064
sp|Q65G95|COAE_BACLD Dephospho-CoA kinase OS=Bacillus lichenifor... 32 0.93
sp|Q9SJ81|FLA7_ARATH Fasciclin-like arabinogalactan protein 7 OS... 32 1.2
sp|P58897|COAE1_CORGL Dephospho-CoA kinase OS=Corynebacterium gl... 31 2.7
sp|Q30NW0|COAE_SULDN Dephospho-CoA kinase OS=Sulfurimonas denitr... 30 3.5
sp|Q7MYD8|ASSY_PHOLL Argininosuccinate synthase OS=Photorhabdus ... 30 3.5
sp|Q8FPN2|COAE_COREF Dephospho-CoA kinase OS=Corynebacterium eff... 30 4.6
sp|Q5ZHX6|S41A2_CHICK Solute carrier family 41 member 2 OS=Gallu... 26 5.7
sp|Q4FP51|METX_PELUB Homoserine O-acetyltransferase OS=Pelagibac... 30 6.0
sp|Q6KZA3|SYP_PICTO Prolyl-tRNA synthetase OS=Picrophilus torrid... 29 7.8
sp|Q8EPE7|COAE_OCEIH Dephospho-CoA kinase OS=Oceanobacillus ihey... 29 7.8

>sp|Q9SU13|FLA2_ARATH Fasciclin-like arabinogalactan protein 2
OS=Arabidopsis thaliana GN=FLA2 PE=1 SV=1
Length = 403

Score = 81.3 bits (199), Expect = 2e-15
Identities = 45/129 (34%), Positives = 73/129 (56%), Gaps = 2/129 (1%)
Frame = -3

Query: 409 DIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVT-IKGSTIELG-RV 236
+I+S HVL+DYF K IT+G++ + +++Q++G A G G++N+T IKG + G +
Sbjct: 86 NILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYINITDIKGGKVAFGVQD 145

Query: 235 DSSVFTATVVSEIYKSPYNISVVSISNILLPTXXXXXXXXXXXVNFTAILIQSKNYNTFL 56
D S TA V +++ PYNISV+ IS +L + T IL + + F
Sbjct: 146 DDSKLTAHYVKSVFEKPYNISVLHISQVLTSPEAEAPTASPSDLILTTIL-EKQGCKAFS 204

Query: 55 SLIKATGVD 29
++K+TG D
Sbjct: 205 DILKSTGAD 213


>sp|O22126|FLA8_ARATH Fasciclin-like arabinogalactan protein 8
OS=Arabidopsis thaliana GN=FLA8 PE=1 SV=1
Length = 420

Score = 77.4 bits (189), Expect = 3e-14
Identities = 49/135 (36%), Positives = 73/135 (54%), Gaps = 3/135 (2%)
Frame = -3

Query: 427 PASTLYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVT-IKGSTI 251
P S + +S VLLDY+D K I+ GT+LSTTLYQT+G A G GF+N+T +KG +
Sbjct: 78 PLSVIKSALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKV 137

Query: 250 ELGRVDS-SVFTATVVSEIYKSPYNISVVSI-SNILLPTXXXXXXXXXXXVNFTAILIQS 77
G S S ++ + + PYNIS++ I + I+ P N T L++
Sbjct: 138 GFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSASLSNITG-LLEK 196

Query: 76 KNYNTFLSLIKATGV 32
TF +L+ ++GV
Sbjct: 197 AGCKTFANLLVSSGV 211


>sp|Q9FM65|FLA1_ARATH Fasciclin-like arabinogalactan protein 1
OS=Arabidopsis thaliana GN=FLA1 PE=1 SV=1
Length = 424

Score = 74.3 bits (181), Expect = 2e-13
Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
Frame = -3

Query: 430 FPASTLYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVT-IKGST 254
+ STL +I+S HVLLDYF K I +G++L+ TL+Q +G A G GF+N+T ++G
Sbjct: 77 YTLSTLKNILSLHVLLDYFGTKKLHQIRDGSALAATLFQATGAAPGTSGFVNITDLRGGK 136

Query: 253 IELGRVDSSVFTATVVSEIYKSPYNISVVSISNIL 149
+ G D ++ V I + PYNIS++ IS +L
Sbjct: 137 VGFG-PDGGDLSSFFVKSIEEVPYNISIIQISRVL 170


>sp|Q9LZX4|FLA10_ARATH Fasciclin-like arabinogalactan protein 10
OS=Arabidopsis thaliana GN=FLA10 PE=1 SV=1
Length = 422

Score = 72.4 bits (176), Expect = 8e-13
Identities = 47/135 (34%), Positives = 73/135 (54%), Gaps = 3/135 (2%)
Frame = -3

Query: 427 PASTLYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVT-IKGSTI 251
P S + + +S VLLDY+D K ++ GT+L+TTLYQT+G A G GF+NVT +KG +
Sbjct: 78 PLSVVKNALSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHALGNLGFVNVTDLKGGKV 137

Query: 250 ELG-RVDSSVFTATVVSEIYKSPYNISVVSI-SNILLPTXXXXXXXXXXXVNFTAILIQS 77
G S ++ + + PYNISV+ I + I+ P V+ L++
Sbjct: 138 GFGSAAPGSKLDSSYTKSVKQIPYNISVLEINAPIIAPGILTAPAPSSAGVSNITGLLEK 197

Query: 76 KNYNTFLSLIKATGV 32
TF +L+ ++GV
Sbjct: 198 AGCKTFANLLVSSGV 212


>sp|Q9ZQ23|FLA3_ARATH Fasciclin-like arabinogalactan protein 3
OS=Arabidopsis thaliana GN=FLA3 PE=2 SV=1
Length = 280

Score = 70.5 bits (171), Expect = 3e-12
Identities = 37/91 (40%), Positives = 55/91 (60%), Gaps = 1/91 (1%)
Frame = -3

Query: 427 PASTLYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVTIKGSTIE 248
P + +I+ HV+LDYFD K KA+ ++L TTLYQ++G + GFLN T I
Sbjct: 76 PEEEVKNILMNHVVLDYFDELKLKALKEKSTLLTTLYQSTGLGQQQNGFLNCTKSNGKIY 135

Query: 247 LGR-VDSSVFTATVVSEIYKSPYNISVVSIS 158
G V + TA ++ ++++PYN+SVV IS
Sbjct: 136 FGSGVKGAPQTAEYITTVFRNPYNLSVVQIS 166


>sp|Q9LTW9|FLA14_ARATH Fasciclin-like arabinogalactan protein 14
OS=Arabidopsis thaliana GN=FLA14 PE=2 SV=1
Length = 255

Score = 70.5 bits (171), Expect = 3e-12
Identities = 38/96 (39%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
Frame = -3

Query: 427 PASTLYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVTI-KGSTI 251
P S + I+S H++LDY+D K K ++ T L TTL+Q+SG A G++GFLN T+ K +
Sbjct: 75 PTSVIKKILSLHIVLDYYDQKKLKNLSKKTVLLTTLFQSSGLARGQQGFLNATVMKNGDV 134

Query: 250 ELG-RVDSSVFTATVVSEIYKSPYNISVVSISNILL 146
G V S A + + P+NISV+ IS+ ++
Sbjct: 135 AFGSAVPGSSLDAQLQDTVAALPFNISVLHISSAIM 170


>sp|O49586|FLA5_ARATH Fasciclin-like arabinogalactan protein 5
OS=Arabidopsis thaliana GN=FLA5 PE=2 SV=1
Length = 278

Score = 64.7 bits (156), Expect = 2e-10
Identities = 33/87 (37%), Positives = 51/87 (58%), Gaps = 1/87 (1%)
Frame = -3

Query: 415 LYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVTIKGSTIELG-R 239
L +I+ HV+LDY+D K + + + + TTLYQT+G GFLNV+ + G
Sbjct: 80 LRNILMTHVILDYYDELKLQGMREKSIMLTTLYQTTGLGEQMNGFLNVSKSKGRVYFGSE 139

Query: 238 VDSSVFTATVVSEIYKSPYNISVVSIS 158
V +S A VS +Y +PYN+S++ I+
Sbjct: 140 VKNSPLNAEYVSTVYHNPYNLSIIQIT 166


>sp|Q9SNC3|FLA4_ARATH Fasciclin-like arabinogalactan protein 4
OS=Arabidopsis thaliana GN=FLA4 PE=1 SV=1
Length = 420

Score = 60.5 bits (145), Expect = 3e-09
Identities = 41/146 (28%), Positives = 68/146 (46%), Gaps = 14/146 (9%)
Frame = -3

Query: 427 PASTLYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVTIKGSTIE 248
P S L D++ +HVLL + + + I S TTLY+ SG+ G +NVT ++
Sbjct: 85 PPSALADLLRFHVLLQFLSDSDLRRIPPSGSAVTTLYEASGRTFFGSGSVNVTRDPASGS 144

Query: 247 LGRVDSSVFTATVVSEIYKSPYNISVVSISNILLPT--------------XXXXXXXXXX 110
+ + TV+ + P NI+V+++ ++++PT
Sbjct: 145 VTIGSPATKNVTVLKLLETKPPNITVLTVDSLIVPTGIDITASETLTPPPTSTSLSPPPA 204

Query: 109 XVNFTAILIQSKNYNTFLSLIKATGV 32
+N T ILI N+N LSL+ A+GV
Sbjct: 205 GINLTQILINGHNFNVALSLLVASGV 230



Score = 30.8 bits (68), Expect = 2.7
Identities = 26/99 (26%), Positives = 49/99 (49%), Gaps = 2/99 (2%)
Frame = -3

Query: 433 TFPASTLYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVT-IKGS 257
+ PA ++ +HVL Y+ + ++ITN + TL + + LN++ + GS
Sbjct: 264 SLPAEQKAFVLKFHVLHSYYTLGSLESITN--PVQPTL--ATEEMGAGSYTLNISRVNGS 319

Query: 256 TIELGRVDSSVFTATVVSEIY-KSPYNISVVSISNILLP 143
+ ++S V A V + ++P +SV +S +LLP
Sbjct: 320 IV---TINSGVVLAVVTQTAFDQNP--VSVFGVSKVLLP 353


>sp|Q8LEE9|FLA12_ARATH Fasciclin-like arabinogalactan protein 12
OS=Arabidopsis thaliana GN=FLA12 PE=2 SV=2
Length = 249

Score = 36.2 bits (82), Expect = 0.064
Identities = 25/89 (28%), Positives = 42/89 (47%)
Frame = -3

Query: 409 DIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVTIKGSTIELGRVDS 230
++I +HV+ Y + F+ I+N L +G + LNVT G+T+ + S
Sbjct: 105 ELIQFHVIPSYVSSSNFQTISN------PLRTQAGDSADGHFPLNVTTSGNTV---NITS 155

Query: 229 SVFTATVVSEIYKSPYNISVVSISNILLP 143
V TV +Y S ++V + +LLP
Sbjct: 156 GVTNTTVSGNVY-SDGQLAVYQVDKVLLP 183


>sp|Q65G95|COAE_BACLD Dephospho-CoA kinase OS=Bacillus licheniformis
(strain DSM 13 / ATCC 14580) GN=coaE PE=3 SV=1
Length = 201

Score = 32.3 bits (72), Expect = 0.93
Identities = 15/42 (35%), Positives = 25/42 (59%)
Frame = +2

Query: 290 LAIGLSRGLVEGRGERSTIGDCLELCNVKVVEKDMVAYDIVE 415
L IGL+ G+ G+ ST+ + C + VV+ D++A + VE
Sbjct: 3 LVIGLTGGIASGK---STVAQMFQQCGITVVDADVIAKEAVE 41


tr_hit_id B8LLV7
Definition tr|B8LLV7|B8LLV7_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 132
Score (bit) 86.7
E-value 5.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911461|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_C03.
(447 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LLV7|B8LLV7_PICSI Putative uncharacterized protein OS=Picea... 87 5e-16
tr|A9NVR3|A9NVR3_PICSI Putative uncharacterized protein OS=Picea... 87 5e-16
tr|A9XTL8|A9XTL8_GOSHI Fasciclin-like arabinogalactan protein 13... 84 3e-15
tr|B8LL14|B8LL14_PICSI Putative uncharacterized protein OS=Picea... 84 5e-15
tr|A9XTL7|A9XTL7_GOSHI Fasciclin-like arabinogalactan protein 12... 83 6e-15
tr|A9XTM4|A9XTM4_GOSHI Fasciclin-like arabinogalactan protein 19... 82 2e-14
tr|B8YBD2|B8YBD2_GOSHI Fascilin-like arabinogalactan protein OS=... 81 2e-14
tr|A7Q984|A7Q984_VITVI Chromosome chr19 scaffold_66, whole genom... 81 2e-14
tr|A7PVG9|A7PVG9_VITVI Chromosome chr9 scaffold_33, whole genome... 80 5e-14
tr|A5ATP0|A5ATP0_VITVI Putative uncharacterized protein OS=Vitis... 80 5e-14
tr|B6TEJ6|B6TEJ6_MAIZE Fasciclin-like arabinogalactan protein 8 ... 79 8e-14
tr|A7P4Z6|A7P4Z6_VITVI Chromosome chr4 scaffold_6, whole genome ... 78 2e-13
tr|A5BYV9|A5BYV9_VITVI Putative uncharacterized protein OS=Vitis... 78 2e-13
tr|Q2PGX7|Q2PGX7_SALEU Putative fasciclin-like arabinogalactan p... 77 3e-13
tr|A9RJU9|A9RJU9_PHYPA Predicted protein OS=Physcomitrella paten... 77 4e-13
tr|A7PY10|A7PY10_VITVI Chromosome chr15 scaffold_37, whole genom... 77 4e-13
tr|A5BB66|A5BB66_VITVI Putative uncharacterized protein OS=Vitis... 77 4e-13
tr|Q67W76|Q67W76_ORYSJ Os06g0656800 protein OS=Oryza sativa subs... 77 6e-13
tr|A7Q2Z9|A7Q2Z9_VITVI Chromosome chr12 scaffold_47, whole genom... 77 6e-13
tr|A5B7N6|A5B7N6_VITVI Putative uncharacterized protein OS=Vitis... 77 6e-13
tr|A2YFS7|A2YFS7_ORYSI Putative uncharacterized protein OS=Oryza... 77 6e-13
tr|A9XTL5|A9XTL5_GOSHI Fasciclin-like arabinogalactan protein 10... 74 4e-12
tr|A9XTL6|A9XTL6_GOSHI Fasciclin-like arabinogalactan protein 11... 74 5e-12
tr|A7NZ17|A7NZ17_VITVI Chromosome chr6 scaffold_3, whole genome ... 74 5e-12
tr|A5BM05|A5BM05_VITVI Putative uncharacterized protein OS=Vitis... 74 5e-12
tr|B4F7Y8|B4F7Y8_MAIZE Putative uncharacterized protein OS=Zea m... 72 1e-11
tr|B6TNT0|B6TNT0_MAIZE Fasciclin-like arabinogalactan protein 8 ... 72 1e-11
tr|Q06I84|Q06I84_WHEAT Fasciclin-like protein FLA22 OS=Triticum ... 72 2e-11
tr|Q2PES4|Q2PES4_TRIPR Putative fasciclin-like arabinogalactan p... 70 4e-11
tr|A0MEV6|A0MEV6_ARATH Putative uncharacterized protein (Fragmen... 70 4e-11

>tr|B8LLV7|B8LLV7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 409

Score = 86.7 bits (213), Expect = 5e-16
Identities = 51/132 (38%), Positives = 73/132 (55%), Gaps = 2/132 (1%)
Frame = -3

Query: 421 STLYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVT-IKGSTIEL 245
++L ++S HV+LD+FD K ITNGT+LSTTLYQT+G A G GF+N+T +K +
Sbjct: 76 ASLKRVLSLHVVLDFFDAKKLHEITNGTTLSTTLYQTTGNAPGNTGFINITDLKAGKVGF 135

Query: 244 G-RVDSSVFTATVVSEIYKSPYNISVVSISNILLPTXXXXXXXXXXXVNFTAILIQSKNY 68
G + AT V + + YNISV+ +S + VN TA+LI+
Sbjct: 136 GPAAHGAKLDATYVKSVKQEGYNISVIEVSKPITTNVAEAPAPAPADVNITAVLIKG-GC 194

Query: 67 NTFLSLIKATGV 32
F ++I TGV
Sbjct: 195 RIFATMISTTGV 206


>tr|A9NVR3|A9NVR3_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 409

Score = 86.7 bits (213), Expect = 5e-16
Identities = 51/132 (38%), Positives = 73/132 (55%), Gaps = 2/132 (1%)
Frame = -3

Query: 421 STLYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVT-IKGSTIEL 245
++L ++S HV+LD+FD K ITNGT+LSTTLYQT+G A G GF+N+T +K +
Sbjct: 76 ASLKRVLSLHVVLDFFDAKKLHEITNGTTLSTTLYQTTGNAPGNTGFINITDLKAGKVGF 135

Query: 244 G-RVDSSVFTATVVSEIYKSPYNISVVSISNILLPTXXXXXXXXXXXVNFTAILIQSKNY 68
G + AT V + + YNISV+ +S + VN TA+LI+
Sbjct: 136 GPAAHGAKLDATYVKSVKQEGYNISVIEVSKPITTNVAEAPAPAPADVNITAVLIKG-GC 194

Query: 67 NTFLSLIKATGV 32
F ++I TGV
Sbjct: 195 RIFATMISTTGV 206


>tr|A9XTL8|A9XTL8_GOSHI Fasciclin-like arabinogalactan protein 13
OS=Gossypium hirsutum GN=FLA13 PE=2 SV=1
Length = 425

Score = 84.0 bits (206), Expect = 3e-15
Identities = 51/135 (37%), Positives = 78/135 (57%), Gaps = 3/135 (2%)
Frame = -3

Query: 427 PASTLYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVT-IKGSTI 251
P S + +I+S HVLLDY+D K I++GT+L+TTLYQT+G A G GF+N+T ++G +
Sbjct: 76 PLSVVKNILSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQGGKV 135

Query: 250 ELG-RVDSSVFTATVVSEIYKSPYNISVVSIS-NILLPTXXXXXXXXXXXVNFTAILIQS 77
G + S ++ + + PYNIS++ IS I+ P VN T L++
Sbjct: 136 GFGSAIPGSKLDSSYTKSVKQIPYNISILEISAPIIAPGILTAPAPSSSGVNITG-LLEK 194

Query: 76 KNYNTFLSLIKATGV 32
TF SL+ ++GV
Sbjct: 195 AGCKTFASLLTSSGV 209


>tr|B8LL14|B8LL14_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 387

Score = 83.6 bits (205), Expect = 5e-15
Identities = 48/126 (38%), Positives = 71/126 (56%), Gaps = 2/126 (1%)
Frame = -3

Query: 403 ISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVT-IKGSTIELGRVD-S 230
+S HV+LD+FD K +TNGT+LSTTLYQT+G A G GF+N+T +KG + G
Sbjct: 78 LSLHVVLDFFDAEKLHQVTNGTTLSTTLYQTTGSAAGNAGFINITDLKGGKVGFGLSGRG 137

Query: 229 SVFTATVVSEIYKSPYNISVVSISNILLPTXXXXXXXXXXXVNFTAILIQSKNYNTFLSL 50
+ +T V + + +N+SVV +S + + +N TA+LI+ F +L
Sbjct: 138 AKLDSTYVKSVKQDGFNLSVVEVSQPITTSVAEAPTPSPSNMNITAVLIKG-GCKIFANL 196

Query: 49 IKATGV 32
I TGV
Sbjct: 197 ISTTGV 202


>tr|A9XTL7|A9XTL7_GOSHI Fasciclin-like arabinogalactan protein 12
OS=Gossypium hirsutum GN=FLA12 PE=2 SV=1
Length = 415

Score = 83.2 bits (204), Expect = 6e-15
Identities = 51/135 (37%), Positives = 78/135 (57%), Gaps = 3/135 (2%)
Frame = -3

Query: 427 PASTLYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVT-IKGSTI 251
P S + +I+S HVLLDY+D K I++GT+L+TTLYQT+G A G GF+N+T ++G +
Sbjct: 78 PLSVVKNILSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQGGKV 137

Query: 250 ELG-RVDSSVFTATVVSEIYKSPYNISVVSIS-NILLPTXXXXXXXXXXXVNFTAILIQS 77
G V S ++ + + PYNIS++ IS I+ P VN T L++
Sbjct: 138 GFGSAVPGSKLDSSYTKSVKQVPYNISILEISAPIIAPGVLSAPAPSASGVNITG-LLEK 196

Query: 76 KNYNTFLSLIKATGV 32
TF +L+ ++GV
Sbjct: 197 AGCKTFANLLTSSGV 211


>tr|A9XTM4|A9XTM4_GOSHI Fasciclin-like arabinogalactan protein 19
OS=Gossypium hirsutum GN=FLA19 PE=2 SV=1
Length = 398

Score = 81.6 bits (200), Expect = 2e-14
Identities = 47/133 (35%), Positives = 74/133 (55%), Gaps = 2/133 (1%)
Frame = -3

Query: 418 TLYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVT-IKGSTIELG 242
TL +++S HVL+DYF K ITNGT+L++T++Q SG A G G++N+T +KG + G
Sbjct: 78 TLKNVLSLHVLVDYFGSKKLHQITNGTALTSTMFQASGAAPGSSGYINITDLKGGKVGFG 137

Query: 241 RVDS-SVFTATVVSEIYKSPYNISVVSISNILLPTXXXXXXXXXXXVNFTAILIQSKNYN 65
++ A V + + PYNISV+ IS +L +N T I+ +
Sbjct: 138 AENNDGNLDAVYVKSVAEIPYNISVLQISQVLNSAEAEAPTAEPSKLNLTEIM-SKQGCK 196

Query: 64 TFLSLIKATGVDA 26
+F L+ ++G DA
Sbjct: 197 SFADLLISSGADA 209


>tr|B8YBD2|B8YBD2_GOSHI Fascilin-like arabinogalactan protein
OS=Gossypium hirsutum GN=FLA PE=2 SV=1
Length = 397

Score = 81.3 bits (199), Expect = 2e-14
Identities = 47/133 (35%), Positives = 73/133 (54%), Gaps = 2/133 (1%)
Frame = -3

Query: 418 TLYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVT-IKGSTIELG 242
TL +++S HVL+DYF K ITNGT+L++T++Q SG A G G++N+T +KG + G
Sbjct: 77 TLKNVLSLHVLVDYFGSKKLHQITNGTALTSTMFQASGAAPGSSGYINITDLKGGKVGFG 136

Query: 241 RVDS-SVFTATVVSEIYKSPYNISVVSISNILLPTXXXXXXXXXXXVNFTAILIQSKNYN 65
++ A V + + PYNISV+ IS +L +N T I+ +
Sbjct: 137 AENNDGNLDAVYVKSVAEIPYNISVLQISQVLNSAEAEAPTAEPSKLNLTEIM-SKQGCK 195

Query: 64 TFLSLIKATGVDA 26
F L+ ++G DA
Sbjct: 196 AFADLLISSGADA 208


>tr|A7Q984|A7Q984_VITVI Chromosome chr19 scaffold_66, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00033374001
PE=4 SV=1
Length = 494

Score = 81.3 bits (199), Expect = 2e-14
Identities = 44/110 (40%), Positives = 62/110 (56%), Gaps = 2/110 (1%)
Frame = -3

Query: 409 DIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVT-IKGSTIELGR-V 236
+++S H+LLDYF K ITNGT+L+ T+YQ +G A G GF+N+T +KG + G
Sbjct: 88 NVLSLHILLDYFGAKKLHQITNGTALAATMYQATGSAPGSSGFVNITDLKGGKVGFGAGG 147

Query: 235 DSSVFTATVVSEIYKSPYNISVVSISNILLPTXXXXXXXXXXXVNFTAIL 86
+ TAT V + + PYNISV+ IS IL N TA++
Sbjct: 148 NDGDLTATFVKSVEEIPYNISVIQISKILPSEEAEAPTPGPSEQNLTALM 197


>tr|A7PVG9|A7PVG9_VITVI Chromosome chr9 scaffold_33, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00025203001
PE=4 SV=1
Length = 464

Score = 80.1 bits (196), Expect = 5e-14
Identities = 38/98 (38%), Positives = 59/98 (60%), Gaps = 2/98 (2%)
Frame = -3

Query: 427 PASTLYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVT--IKGST 254
P + ++S HV+LDYFD+ K + + N T+ TL+Q SG++ G++GFLNVT G
Sbjct: 68 PKDVIKKVVSLHVVLDYFDVPKLQKLPNNTATLPTLFQASGESTGQQGFLNVTHLSTGGV 127

Query: 253 IELGRVDSSVFTATVVSEIYKSPYNISVVSISNILLPT 140
+ V + A +V I PYNISV+ IS +++P+
Sbjct: 128 VFGSAVHGTTLGANLVKSIASQPYNISVLQISTVIIPS 165


>tr|A5ATP0|A5ATP0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_011795 PE=4 SV=1
Length = 365

Score = 80.1 bits (196), Expect = 5e-14
Identities = 38/98 (38%), Positives = 59/98 (60%), Gaps = 2/98 (2%)
Frame = -3

Query: 427 PASTLYDIISYHVLLDYFDIAKFKAITNGTSLSTTLYQTSGQANGKEGFLNVT--IKGST 254
P + ++S HV+LDYFD+ K + + N T+ TL+Q SG++ G++GFLNVT G
Sbjct: 77 PKDVIKKVVSLHVVLDYFDVPKLQKLPNNTATLPTLFQASGESTGQQGFLNVTHLSTGGV 136

Query: 253 IELGRVDSSVFTATVVSEIYKSPYNISVVSISNILLPT 140
+ V + A +V I PYNISV+ IS +++P+
Sbjct: 137 VFGSAVHGTTLGANLVKSIASQPYNISVLQISTVIIPS 174