BP911473
Clone id YMU001_000005_D04
Library
Length 513
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000005_D04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATGTATTGCTACTTGAGAATGTGCCCACTTCAGACATTTGCCCACCATGCCTTGAATAGA
TAGCCTCAAGGGGTGGTTTACGGATATCAGAATCGTCTCTTCGAAGCTCTACACGAATAA
AAAGGTTTTTCTTTCGACTGAGACTTGCAACTCGAGGATAAACATAGAGAGAATGTAAAA
GTTGAGTAAATGGTTCACTTCGGGTGAAATTTCGAAAATCCAAGGCATGGAAATCATTAC
TTCCACTTGAACCACCAAATCCTCTGGCAGCCTTTCCATCTTTAAGATCTGGGGTAAGCC
ACTTCGTCTGGCCATTGAAGGGTCCACGATGGATACCATGCACACCATTGGTATGTCCTC
TGTCTATGGACATATCACCATAACAATCACCACCCTCAGCTGAACCATTACTGGCCCTAC
TACCCTCAGAAATTGCTTCAGTATCAAAGTAGCCCATTTGCAGCCTTTCCACCTCCAATC
GCAAAGTAGCTTTAACAGGTTTGTGAACTTTCT
■■Homology search results ■■ -
sp_hit_id Q9BZ29
Definition sp|Q9BZ29|DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens
Align length 69
Score (bit) 35.8
E-value 0.12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911473|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_D04.
(513 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9BZ29|DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo... 36 0.12
sp|Q8MP30|Y7791_DICDI Uncharacterized histidine-rich protein DDB... 35 0.16
sp|Q8BIK4|DOCK9_MOUSE Dedicator of cytokinesis protein 9 OS=Mus ... 35 0.20
sp|Q64733|FOXB2_MOUSE Forkhead box protein B2 OS=Mus musculus GN... 33 1.0
sp|P04929|HRPX_PLALO Histidine-rich glycoprotein OS=Plasmodium l... 32 1.3
sp|Q5VYV0|FOXB2_HUMAN Forkhead box protein B2 OS=Homo sapiens GN... 31 3.0
sp|Q4V887|S39A6_RAT Zinc transporter ZIP6 OS=Rattus norvegicus G... 30 5.1
sp|Q5R9M9|S39A6_PONAB Zinc transporter ZIP6 OS=Pongo abelii GN=S... 30 5.1
sp|Q8C145|S39A6_MOUSE Zinc transporter ZIP6 OS=Mus musculus GN=S... 30 5.1
sp|Q13433|S39A6_HUMAN Zinc transporter ZIP6 OS=Homo sapiens GN=S... 30 5.1
sp|Q5M8L8|HVCN1_XENTR Voltage-gated hydrogen channel 1 OS=Xenopu... 30 5.1
sp|Q9HE26|FBRL_NEUCR rRNA 2'-O-methyltransferase fibrillarin OS=... 30 6.5
sp|Q9LUP2|FB155_ARATH Putative F-box protein At3g17560 OS=Arabid... 30 6.5
sp|Q504L8|MAFB_XENTR Transcription factor MafB OS=Xenopus tropic... 30 6.7
sp|P06719|KNOB_PLAFN Knob-associated histidine-rich protein OS=P... 30 6.7
sp|Q00939|FOXG1_RAT Forkhead box protein G1 OS=Rattus norvegicus... 30 6.7
sp|Q1A1A4|FOXG1_PIPRU Forkhead box protein G1 OS=Pipistrellus ru... 30 6.7
sp|Q60987|FOXG1_MOUSE Forkhead box protein G1 OS=Mus musculus GN... 30 6.7
sp|Q1A1A3|FOXG1_EPOGA Forkhead box protein G1 OS=Epomophorus gam... 30 6.7
sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 ... 30 8.5
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Ara... 30 8.5
sp|Q8CIS9|K1C9_RAT Keratin, type I cytoskeletal 9 OS=Rattus norv... 30 8.5
sp|P33244|FTZF1_DROME Nuclear hormone receptor FTZ-F1 OS=Drosoph... 30 8.5
sp|Q92570|NR4A3_HUMAN Nuclear receptor subfamily 4 group A membe... 30 8.7
sp|Q1A1A1|FOXG1_CERSI Forkhead box protein G1 OS=Ceratotherium s... 30 8.7

>sp|Q9BZ29|DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo
sapiens GN=DOCK9 PE=1 SV=2
Length = 2069

Score = 35.8 bits (81), Expect = 0.12
Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 6/69 (8%)
Frame = -3

Query: 199 SEPFTQLLHSLYVYPRV------ASLSRKKNLFIRVELRRDDSDIRKPPLEAIYSRHGGQ 38
++P+T + LYVYP+ S ++ +N+ I +E + D + PL+ IY R GG
Sbjct: 633 TQPYTIYTNHLYVYPKYLKYDSQKSFAKARNIAICIEFKDSDEE-DSQPLKCIYGRPGGP 691

Query: 37 MSEVGTFSS 11
+ F++
Sbjct: 692 VFTRSAFAA 700


>sp|Q8MP30|Y7791_DICDI Uncharacterized histidine-rich protein
DDB0167791 OS=Dictyostelium discoideum GN=DDB_G0274557
PE=4 SV=1
Length = 233

Score = 35.4 bits (80), Expect = 0.16
Identities = 18/69 (26%), Positives = 28/69 (40%)
Frame = +1

Query: 217 NPRHGNHYFHLNHQILWQPFHL*DLG*ATSSGH*RVHDGYHAHHWYVLCLWTYHHNNHHP 396
NP H +H H +H H H +H HH + +HH++HHP
Sbjct: 63 NPHHPHHLHHHHH-------------------HHHHHHHHHHHHHH------HHHHHHHP 97

Query: 397 QLNHYWPYY 423
H+ P++
Sbjct: 98 HHPHHHPHH 106



Score = 34.7 bits (78), Expect = 0.27
Identities = 20/73 (27%), Positives = 30/73 (41%)
Frame = +1

Query: 208 NFENPRHGNHYFHLNHQILWQPFHL*DLG*ATSSGH*RVHDGYHAHHWYVLCLWTYHHNN 387
N NP + H H + P HL H H +H HH +HH++
Sbjct: 46 NPHNPNNNPHNPHNPNNNPHHPHHL----------HHHHHHHHHHHH--------HHHHH 87

Query: 388 HHPQLNHYWPYYP 426
HH +H+ P++P
Sbjct: 88 HHHHHHHHHPHHP 100



Score = 33.1 bits (74), Expect = 0.79
Identities = 18/76 (23%), Positives = 32/76 (42%)
Frame = +1

Query: 196 HFG*NFENPRHGNHYFHLNHQILWQPFHL*DLG*ATSSGH*RVHDGYHAHHWYVLCLWTY 375
H + +P H +H+ H +H H H H +H HH + +
Sbjct: 89 HHHHHHHHPHHPHHHPHHHHHPHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHH 141

Query: 376 HHNNHHPQLNHYWPYY 423
HH++HH +H+ P++
Sbjct: 142 HHHHHHHHHHHHHPHH 157



Score = 32.3 bits (72), Expect = 1.3
Identities = 18/75 (24%), Positives = 30/75 (40%)
Frame = +1

Query: 196 HFG*NFENPRHGNHYFHLNHQILWQPFHL*DLG*ATSSGH*RVHDGYHAHHWYVLCLWTY 375
H + +P H +H+ H +H H H H +H HH + +
Sbjct: 102 HHPHHHHHPHHHHHHHHHHHHHHHHHHH-----------HHHHHHHHHHHHHH-----HH 145

Query: 376 HHNNHHPQLNHYWPY 420
HH++HH H+ P+
Sbjct: 146 HHHHHHHHHPHHHPH 160


>sp|Q8BIK4|DOCK9_MOUSE Dedicator of cytokinesis protein 9 OS=Mus
musculus GN=Dock9 PE=1 SV=2
Length = 2055

Score = 35.0 bits (79), Expect = 0.20
Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 6/59 (10%)
Frame = -3

Query: 199 SEPFTQLLHSLYVYPRV------ASLSRKKNLFIRVELRRDDSDIRKPPLEAIYSRHGG 41
++P+T + LYVYP+ S ++ +N+ I +E + D + PL+ IY R GG
Sbjct: 642 TQPYTVYSNHLYVYPKYLKYDSQKSFAKARNIAICIEFKDSDEE-DSQPLKCIYGRPGG 699


>sp|Q64733|FOXB2_MOUSE Forkhead box protein B2 OS=Mus musculus
GN=Foxb2 PE=2 SV=1
Length = 428

Score = 32.7 bits (73), Expect = 1.0
Identities = 14/40 (35%), Positives = 21/40 (52%)
Frame = +1

Query: 310 GH*RVHDGYHAHHWYVLCLWTYHHNNHHPQLNHYWPYYPQ 429
GH H +HAHH +HH++HH +H+ + PQ
Sbjct: 134 GHLHPHHPHHAHH--------HHHHHHHAAHHHHHHHPPQ 165


>sp|P04929|HRPX_PLALO Histidine-rich glycoprotein OS=Plasmodium
lophurae PE=4 SV=1
Length = 351

Score = 32.3 bits (72), Expect = 1.3
Identities = 25/102 (24%), Positives = 37/102 (36%), Gaps = 6/102 (5%)
Frame = +1

Query: 157 DKHRENVKVE*MVHFG*NFENPRHGNHYFHL----NHQILWQPFHL*DLG*ATSSGH*RV 324
++H E E H P H H+ H +H P H LG H
Sbjct: 67 EEHHEPHHEEHHHHHPEEHHEPHHEEHHHHHPHPHHHHHHHPPHHHHHLGHHHHHHHAAH 126

Query: 325 HDGYHAHHWYVLCLWTYHH--NNHHPQLNHYWPYYPQKLLQY 444
H + HH + +HH ++HH H+ P++ L Y
Sbjct: 127 HHHHEEHHHHHHAAHHHHHEEHHHHHHAAHHHPWFHHHHLGY 168



Score = 32.0 bits (71), Expect = 1.8
Identities = 16/62 (25%), Positives = 26/62 (41%)
Frame = +1

Query: 226 HGNHYFHLNHQILWQPFHL*DLG*ATSSGH*RVHDGYHAHHWYVLCLWTYHHNNHHPQLN 405
HG+H+ H +H H HD +H HH + +HH++HH +
Sbjct: 242 HGHHHHHHHHHDAHHHHH-------------HHHDAHHHHHHH---HDAHHHHHHHHDAH 285

Query: 406 HY 411
H+
Sbjct: 286 HH 287



Score = 31.6 bits (70), Expect = 2.3
Identities = 16/62 (25%), Positives = 26/62 (41%)
Frame = +1

Query: 226 HGNHYFHLNHQILWQPFHL*DLG*ATSSGH*RVHDGYHAHHWYVLCLWTYHHNNHHPQLN 405
HG+H+ H +H H HD +H HH + +HH++HH +
Sbjct: 232 HGHHHHHHHHH-------------GHHHHHHHHHDAHHHHHHH---HDAHHHHHHHHDAH 275

Query: 406 HY 411
H+
Sbjct: 276 HH 277



Score = 31.2 bits (69), Expect = 3.0
Identities = 17/62 (27%), Positives = 26/62 (41%)
Frame = +1

Query: 226 HGNHYFHLNHQILWQPFHL*DLG*ATSSGH*RVHDGYHAHHWYVLCLWTYHHNNHHPQLN 405
H H+ H +H H D H HD +H HH + +HH++HH +
Sbjct: 292 HDAHHHHHHHHDAHHHHHHHD----AHHHHHHHHDAHHHHHHH---HDAHHHHHHHHDAH 344

Query: 406 HY 411
H+
Sbjct: 345 HH 346



Score = 30.8 bits (68), Expect = 3.9
Identities = 16/60 (26%), Positives = 26/60 (43%)
Frame = +1

Query: 232 NHYFHLNHQILWQPFHL*DLG*ATSSGH*RVHDGYHAHHWYVLCLWTYHHNNHHPQLNHY 411
+H+ H +H H D H HD +H HH + +HH++HH +H+
Sbjct: 275 HHHHHHHHDAHHHHHHHHD----AHHHHHHHHDAHHHHHHHD----AHHHHHHHHDAHHH 326



Score = 30.4 bits (67), Expect = 5.1
Identities = 16/62 (25%), Positives = 26/62 (41%)
Frame = +1

Query: 226 HGNHYFHLNHQILWQPFHL*DLG*ATSSGH*RVHDGYHAHHWYVLCLWTYHHNNHHPQLN 405
HG+H+ H +H H H G+H HH + +HH++HH +
Sbjct: 222 HGHHHHHHHHH--------------GHHHHHHHHHGHHHHHHHHHD--AHHHHHHHHDAH 265

Query: 406 HY 411
H+
Sbjct: 266 HH 267



Score = 30.0 bits (66), Expect = 6.7
Identities = 16/60 (26%), Positives = 27/60 (45%)
Frame = +1

Query: 232 NHYFHLNHQILWQPFHL*DLG*ATSSGH*RVHDGYHAHHWYVLCLWTYHHNNHHPQLNHY 411
+H+ H +H H D + H HD +H HH + +HH++HH +H+
Sbjct: 285 HHHHHHHHDAHHHHHHHHD-----AHHHHHHHDAHHHHHHH---HDAHHHHHHHHDAHHH 336



Score = 30.0 bits (66), Expect = 6.7
Identities = 17/62 (27%), Positives = 24/62 (38%)
Frame = +1

Query: 226 HGNHYFHLNHQILWQPFHL*DLG*ATSSGH*RVHDGYHAHHWYVLCLWTYHHNNHHPQLN 405
H H+ H +H H D H HD +H HH +HH+ HH +
Sbjct: 302 HDAHHHHHHHDAHHHHHHHHD----AHHHHHHHHDAHHHHH--------HHHDAHHHHHH 349

Query: 406 HY 411
H+
Sbjct: 350 HH 351



Score = 29.6 bits (65), Expect = 8.7
Identities = 19/68 (27%), Positives = 28/68 (41%), Gaps = 3/68 (4%)
Frame = +1

Query: 232 NHYFHLNHQILWQPFHL*DLG*ATSSG---H*RVHDGYHAHHWYVLCLWTYHHNNHHPQL 402
+H+ H H W FH LG H H H HH + +HH++H P
Sbjct: 149 HHHHHAAHHHPW--FHHHHLGYHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHH 206

Query: 403 NHYWPYYP 426
+H+ + P
Sbjct: 207 HHHHHHAP 214


>sp|Q5VYV0|FOXB2_HUMAN Forkhead box protein B2 OS=Homo sapiens
GN=FOXB2 PE=2 SV=1
Length = 432

Score = 31.2 bits (69), Expect = 3.0
Identities = 12/33 (36%), Positives = 17/33 (51%)
Frame = +1

Query: 298 ATSSGH*RVHDGYHAHHWYVLCLWTYHHNNHHP 396
A GH H +H HH + +HH++HHP
Sbjct: 130 AGPGGHLHPHHHHHPHHHHHHHAAAHHHHHHHP 162


>sp|Q4V887|S39A6_RAT Zinc transporter ZIP6 OS=Rattus norvegicus
GN=Slc39a6 PE=2 SV=1
Length = 741

Score = 30.4 bits (67), Expect = 5.1
Identities = 15/36 (41%), Positives = 19/36 (52%)
Frame = +1

Query: 328 DGYHAHHWYVLCLWTYHHNNHHPQLNHYWPYYPQKL 435
D H HH Y L +HH NHHP +H Y ++L
Sbjct: 539 DLIHHHHDYHHILHHHHHQNHHPH-SHSQRYSREEL 573


>sp|Q5R9M9|S39A6_PONAB Zinc transporter ZIP6 OS=Pongo abelii
GN=SLC39A6 PE=2 SV=1
Length = 743

Score = 30.4 bits (67), Expect = 5.1
Identities = 15/36 (41%), Positives = 19/36 (52%)
Frame = +1

Query: 328 DGYHAHHWYVLCLWTYHHNNHHPQLNHYWPYYPQKL 435
D H HH Y L +HH NHHP +H Y ++L
Sbjct: 541 DLIHHHHDYHHILHHHHHQNHHPH-SHSQRYSREEL 575


>sp|Q8C145|S39A6_MOUSE Zinc transporter ZIP6 OS=Mus musculus
GN=Slc39a6 PE=2 SV=1
Length = 765

Score = 30.4 bits (67), Expect = 5.1
Identities = 15/36 (41%), Positives = 19/36 (52%)
Frame = +1

Query: 328 DGYHAHHWYVLCLWTYHHNNHHPQLNHYWPYYPQKL 435
D H HH Y L +HH NHHP +H Y ++L
Sbjct: 563 DLIHHHHDYHHILHHHHHQNHHPH-SHSQRYSREEL 597


>sp|Q13433|S39A6_HUMAN Zinc transporter ZIP6 OS=Homo sapiens
GN=SLC39A6 PE=1 SV=2
Length = 749

Score = 30.4 bits (67), Expect = 5.1
Identities = 15/36 (41%), Positives = 19/36 (52%)
Frame = +1

Query: 328 DGYHAHHWYVLCLWTYHHNNHHPQLNHYWPYYPQKL 435
D H HH Y L +HH NHHP +H Y ++L
Sbjct: 547 DLIHHHHDYHHILHHHHHQNHHPH-SHSQRYSREEL 581


tr_hit_id A7PDN1
Definition tr|A7PDN1|A7PDN1_VITVI Chromosome chr11 scaffold_13, whole genome shotgun sequence OS=Vitis vinifera
Align length 160
Score (bit) 142.0
E-value 1.0e-32
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911473|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_D04.
(513 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PDN1|A7PDN1_VITVI Chromosome chr11 scaffold_13, whole genom... 142 1e-32
tr|Q8SAB7|Q8SAB7_ARATH Putative guanine nucleotide exchange fact... 134 3e-30
tr|Q8H7M0|Q8H7M0_ORYSJ Putative adapter protein SPIKE1 (Putative... 133 4e-30
tr|B8ANH1|B8ANH1_ORYSI Putative uncharacterized protein OS=Oryza... 133 4e-30
tr|A9TS39|A9TS39_PHYPA Predicted protein OS=Physcomitrella paten... 129 1e-28
tr|A9SAL7|A9SAL7_PHYPA Predicted protein OS=Physcomitrella paten... 124 2e-27
tr|A9RS98|A9RS98_PHYPA Predicted protein OS=Physcomitrella paten... 120 4e-26
tr|A9S9U4|A9S9U4_PHYPA Predicted protein OS=Physcomitrella paten... 118 2e-25
tr|A9TTW3|A9TTW3_PHYPA Predicted protein OS=Physcomitrella paten... 116 6e-25
tr|A9T077|A9T077_PHYPA Predicted protein OS=Physcomitrella paten... 110 3e-23
tr|Q8SSW5|Q8SSW5_DICDI Similar to Homo sapiens (Human). KIAA1395... 39 0.19
tr|Q554I8|Q554I8_DICDI DOCK family protein OS=Dictyostelium disc... 39 0.19
tr|Q29NX4|Q29NX4_DROPS GA19738 OS=Drosophila pseudoobscura pseud... 38 0.25
tr|Q09633|Q09633_CAEEL Rnase h protein 1.1 OS=Caenorhabditis ele... 38 0.25
tr|B4GJQ7|B4GJQ7_DROPE GL25926 OS=Drosophila persimilis GN=GL259... 38 0.25
tr|Q1B433|Q1B433_MYCSS Putative uncharacterized protein OS=Mycob... 38 0.33
tr|A3Q5G3|A3Q5G3_MYCSJ Putative uncharacterized protein OS=Mycob... 38 0.33
tr|A1UL15|A1UL15_MYCSK Putative uncharacterized protein OS=Mycob... 38 0.33
tr|B4Q5Q3|B4Q5Q3_DROSI GD22490 OS=Drosophila simulans GN=GD22490... 38 0.33
tr|A7T5X3|A7T5X3_NEMVE Predicted protein (Fragment) OS=Nematoste... 38 0.34
tr|Q4S301|Q4S301_TETNG Chromosome 3 SCAF14756, whole genome shot... 37 0.43
tr|B4MZU5|B4MZU5_DROWI GK24720 (Fragment) OS=Drosophila willisto... 37 0.43
tr|B4KKA1|B4KKA1_DROMO GI17779 OS=Drosophila mojavensis GN=GI177... 37 0.43
tr|A7SQX7|A7SQX7_NEMVE Predicted protein (Fragment) OS=Nematoste... 37 0.44
tr|Q9VM04|Q9VM04_DROME CG6630 OS=Drosophila melanogaster GN=CG42... 37 0.56
tr|B4NZJ8|B4NZJ8_DROYA GE18354 OS=Drosophila yakuba GN=GE18354 P... 37 0.56
tr|B4HY70|B4HY70_DROSE GM13544 OS=Drosophila sechellia GN=GM1354... 37 0.56
tr|B3N6K7|B3N6K7_DROER GG23528 OS=Drosophila erecta GN=GG23528 P... 37 0.56
tr|B3MKB5|B3MKB5_DROAN GF15863 OS=Drosophila ananassae GN=GF1586... 37 0.56
tr|B4LRV0|B4LRV0_DROVI GJ17604 OS=Drosophila virilis GN=GJ17604 ... 37 0.74

>tr|A7PDN1|A7PDN1_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016346001
PE=4 SV=1
Length = 1844

Score = 142 bits (358), Expect = 1e-32
Identities = 79/160 (49%), Positives = 100/160 (62%), Gaps = 3/160 (1%)
Frame = -3

Query: 511 KVHKPVKATLRLEVERLQMGYFDTEAISEGSRASNGSAEGGDCYGDMSIDRGHTNGVHGI 332
KVHKPVK LRLE+E+LQ G+ D E ISE +N S + GD D + + +NG G
Sbjct: 366 KVHKPVKGVLRLEIEKLQAGHADLENISESGSVTNDSIDPGDRIADSTFTKCPSNGSDG- 424

Query: 331 HRGPFNGQTKWLTPDLKD--GKAARGFGGSS-GSNDFHALDFRNFTRSEPFTQLLHSLYV 161
P N +KW D K+ + FG S ++DF A DFR+ TR+EPF QL H LYV
Sbjct: 425 ---PQNSNSKWNFFDGKEIPRNGSNAFGYSDFNADDFQAFDFRSTTRNEPFLQLFHCLYV 481

Query: 160 YPRVASLSRKKNLFIRVELRRDDSDIRKPPLEAIYSRHGG 41
YP SLSRK+NLFIR+ELR+DD+D R+ PLEA+ R G
Sbjct: 482 YPLTVSLSRKRNLFIRIELRKDDADARRQPLEAMCMREPG 521


>tr|Q8SAB7|Q8SAB7_ARATH Putative guanine nucleotide exchange factor
OS=Arabidopsis thaliana GN=SPK1 PE=2 SV=1
Length = 1830

Score = 134 bits (336), Expect = 3e-30
Identities = 76/160 (47%), Positives = 99/160 (61%), Gaps = 3/160 (1%)
Frame = -3

Query: 511 KVHKPVKATLRLEVERLQMGYFDTEAISEGSRASNGSAEGGDCYGDMSIDRGHTNGVHGI 332
KVHKPVK LRLE+E+ + G+ D E +SE N S + D D+++ + ++
Sbjct: 355 KVHKPVKGVLRLEIEKHRNGHGDFEDLSENGSIINDSLDPTDRLSDLTLMKCPSSS---- 410

Query: 331 HRGPFNGQTKWLTPDLKDGKAARGFGGSSGSND---FHALDFRNFTRSEPFTQLLHSLYV 161
GP NG +KW + D KD +R S G+ D +HA DF + TR+EPF L H LYV
Sbjct: 411 SGGPRNGCSKWNSEDAKD--VSRNLTSSCGTPDLNCYHAFDFCSTTRNEPFLHLFHCLYV 468

Query: 160 YPRVASLSRKKNLFIRVELRRDDSDIRKPPLEAIYSRHGG 41
YP +LSRK+N FIRVELR+DD+DIRK PLEAIY R G
Sbjct: 469 YPVAVTLSRKRNPFIRVELRKDDTDIRKQPLEAIYPREPG 508


>tr|Q8H7M0|Q8H7M0_ORYSJ Putative adapter protein SPIKE1 (Putative
uncharacterized protein) OS=Oryza sativa subsp. japonica
GN=OSJNBb0014I10.6 PE=4 SV=1
Length = 1852

Score = 133 bits (334), Expect(2) = 4e-30
Identities = 77/154 (50%), Positives = 97/154 (62%)
Frame = -3

Query: 511 KVHKPVKATLRLEVERLQMGYFDTEAISEGSRASNGSAEGGDCYGDMSIDRGHTNGVHGI 332
KVHKPVK LRLEVE+L G+ D + ISEG +N + G+ ++ R + + GI
Sbjct: 366 KVHKPVKGVLRLEVEKLHNGHNDMDNISEGGSMANDLNDAGE----LNNGRYNRSSFDGI 421

Query: 331 HRGPFNGQTKWLTPDLKDGKAARGFGGSSGSNDFHALDFRNFTRSEPFTQLLHSLYVYPR 152
H G N ++G+A+ SG N F A DFR TRSEPF+QL H LYVYP
Sbjct: 422 H-GSLNSSAVAQKDAHQNGQASNT---ESGEN-FQAFDFRMMTRSEPFSQLFHCLYVYPL 476

Query: 151 VASLSRKKNLFIRVELRRDDSDIRKPPLEAIYSR 50
SL RK+NLF+RVELR+DDSDIRKPPLEA++ R
Sbjct: 477 TISLGRKRNLFVRVELRKDDSDIRKPPLEAVHPR 510



Score = 21.6 bits (44), Expect(2) = 4e-30
Identities = 6/9 (66%), Positives = 9/9 (100%)
Frame = -1

Query: 30 KWAHSQVAI 4
KWAH+Q+A+
Sbjct: 518 KWAHTQIAV 526


>tr|B8ANH1|B8ANH1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_11399 PE=4 SV=1
Length = 1757

Score = 133 bits (334), Expect(2) = 4e-30
Identities = 77/154 (50%), Positives = 97/154 (62%)
Frame = -3

Query: 511 KVHKPVKATLRLEVERLQMGYFDTEAISEGSRASNGSAEGGDCYGDMSIDRGHTNGVHGI 332
KVHKPVK LRLEVE+L G+ D + ISEG +N + G+ ++ R + + GI
Sbjct: 366 KVHKPVKGVLRLEVEKLHNGHNDMDNISEGGSMANDLNDAGE----LNNGRYNRSSFDGI 421

Query: 331 HRGPFNGQTKWLTPDLKDGKAARGFGGSSGSNDFHALDFRNFTRSEPFTQLLHSLYVYPR 152
H G N ++G+A+ SG N F A DFR TRSEPF+QL H LYVYP
Sbjct: 422 H-GSLNSSAVAQKDAHQNGQASNT---ESGEN-FQAFDFRMMTRSEPFSQLFHCLYVYPL 476

Query: 151 VASLSRKKNLFIRVELRRDDSDIRKPPLEAIYSR 50
SL RK+NLF+RVELR+DDSDIRKPPLEA++ R
Sbjct: 477 TISLGRKRNLFVRVELRKDDSDIRKPPLEAVHPR 510



Score = 21.6 bits (44), Expect(2) = 4e-30
Identities = 6/9 (66%), Positives = 9/9 (100%)
Frame = -1

Query: 30 KWAHSQVAI 4
KWAH+Q+A+
Sbjct: 518 KWAHTQIAV 526


>tr|A9TS39|A9TS39_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_171616 PE=4 SV=1
Length = 1954

Score = 129 bits (323), Expect = 1e-28
Identities = 72/159 (45%), Positives = 96/159 (60%), Gaps = 7/159 (4%)
Frame = -3

Query: 505 HKPVKATLRLEVERLQMGYFDTEAISEGSRASNGSAEGGDCYGDMSIDRGHTNGVHGIHR 326
HKPVKATLRLEVER+ + +AISE SN S EG + S+ R G+ R
Sbjct: 473 HKPVKATLRLEVERVSQDEVEQDAISECGSFSNSSIEGEG--REASLSRHLPQASSGVSR 530

Query: 325 GPFNGQTKWLTPDLKDGKAARGFGGSSGSNDFH-------ALDFRNFTRSEPFTQLLHSL 167
G F+G+ KW + D R S+ +N F A++FR R + +Q+LH L
Sbjct: 531 GAFSGRPKWSSMD------KRRLAHSASANSFEFLRPHFKAIEFRTSNRGDLMSQMLHCL 584

Query: 166 YVYPRVASLSRKKNLFIRVELRRDDSDIRKPPLEAIYSR 50
Y+YP+ +LS+K+NLF+RVELR+DD DIRKPPLEA+Y R
Sbjct: 585 YIYPQTLNLSKKRNLFVRVELRKDDYDIRKPPLEALYPR 623


>tr|A9SAL7|A9SAL7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_126583 PE=4 SV=1
Length = 1866

Score = 124 bits (312), Expect = 2e-27
Identities = 71/155 (45%), Positives = 96/155 (61%), Gaps = 1/155 (0%)
Frame = -3

Query: 511 KVHKPVKATLRLEVERLQMGYFDTEAISEGSRASNGSAEGGD-CYGDMSIDRGHTNGVHG 335
KVHKP+KATLRLE+ERL + + ISE NGS + G S+ T G+
Sbjct: 372 KVHKPMKATLRLEIERLSNDDHEADCISECGSFGNGSYDADSRSIGGASLSGRSTQGLE- 430

Query: 334 IHRGPFNGQTKWLTPDLKDGKAARGFGGSSGSNDFHALDFRNFTRSEPFTQLLHSLYVYP 155
+ +NG K +P ++ ++ G G ++F A++FR + EP QLLH LYVYP
Sbjct: 431 FTKALYNGHQKG-SPVHRELHSSSGSSLELGRSEFRAVEFRLGLKPEPLPQLLHCLYVYP 489

Query: 154 RVASLSRKKNLFIRVELRRDDSDIRKPPLEAIYSR 50
+ +L+RK+NLFIR+ELR DDSDIRKPPLEA+Y R
Sbjct: 490 QSVNLNRKRNLFIRIELRNDDSDIRKPPLEALYPR 524


>tr|A9RS98|A9RS98_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_177678 PE=4 SV=1
Length = 1857

Score = 120 bits (301), Expect = 4e-26
Identities = 70/154 (45%), Positives = 95/154 (61%)
Frame = -3

Query: 511 KVHKPVKATLRLEVERLQMGYFDTEAISEGSRASNGSAEGGDCYGDMSIDRGHTNGVHGI 332
KVHKPVKA LRLE+ERL + + ISE SNGS + S+ + G+
Sbjct: 367 KVHKPVKAILRLEIERLGSDDHEADCISECGSFSNGSFDADSRSIGASLSGRSSQGLE-F 425

Query: 331 HRGPFNGQTKWLTPDLKDGKAARGFGGSSGSNDFHALDFRNFTRSEPFTQLLHSLYVYPR 152
+ +NG K +P +D + G G ++F A+++R + EP +QLLH LYVYP+
Sbjct: 426 TKALYNGYQK-NSPVHRDLLSGSGSSLDLGRSEFRAVEYRLGPKPEPLSQLLHCLYVYPQ 484

Query: 151 VASLSRKKNLFIRVELRRDDSDIRKPPLEAIYSR 50
+L+RK+NLFIR+ELR DDSDIRKPPLEA+Y R
Sbjct: 485 SVTLNRKRNLFIRLELRVDDSDIRKPPLEALYPR 518


>tr|A9S9U4|A9S9U4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_126534 PE=4 SV=1
Length = 1872

Score = 118 bits (295), Expect = 2e-25
Identities = 72/156 (46%), Positives = 91/156 (58%), Gaps = 2/156 (1%)
Frame = -3

Query: 511 KVHKPVKATLRLEVERLQMGYFDTEAISEGSRASNGSAEGGDCYGDMSIDRGHTNGVHGI 332
KVHKPVKA LRLE+ERL D ++I E GS +G G G+
Sbjct: 358 KVHKPVKAILRLEIERLSTEDHDQDSIFECGSFGRGSTDGDSRLTVGPSFSGRFMQGLGM 417

Query: 331 HRGPFNGQTKWLTPDLKDGKAARGFGGSS--GSNDFHALDFRNFTRSEPFTQLLHSLYVY 158
+ NG+ KW +P K G GS G DF A++FR+ ++ E QLLH LYVY
Sbjct: 418 TKVTHNGRQKW-SPGRKHRYLHSGSVGSIEFGKFDFRAIEFRSGSKVEVLPQLLHCLYVY 476

Query: 157 PRVASLSRKKNLFIRVELRRDDSDIRKPPLEAIYSR 50
P+ +LSRK+NLF+RVELR+DD DIRK PLEA+Y R
Sbjct: 477 PQSVNLSRKRNLFVRVELRKDDVDIRKSPLEALYPR 512


>tr|A9TTW3|A9TTW3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_198239 PE=4 SV=1
Length = 1853

Score = 116 bits (291), Expect = 6e-25
Identities = 65/152 (42%), Positives = 92/152 (60%)
Frame = -3

Query: 505 HKPVKATLRLEVERLQMGYFDTEAISEGSRASNGSAEGGDCYGDMSIDRGHTNGVHGIHR 326
HKPVKATLRLEVER+ + ++SE SN S +G + S+ R + G R
Sbjct: 375 HKPVKATLRLEVERVSQEDVERGSLSECGSFSNSSIDGEG--RESSLPRHLRHASSGYSR 432

Query: 325 GPFNGQTKWLTPDLKDGKAARGFGGSSGSNDFHALDFRNFTRSEPFTQLLHSLYVYPRVA 146
G +G+ K + D + ++ F A++FR R EP +Q+LH LY+YP+
Sbjct: 433 GALSGRLKLSSMDKR-----------RLAHSFKAIEFRTSNRGEPMSQVLHCLYIYPQTI 481

Query: 145 SLSRKKNLFIRVELRRDDSDIRKPPLEAIYSR 50
+LS+K+NLF+RVELR+DD DIR+PPLEA+Y R
Sbjct: 482 NLSKKRNLFVRVELRKDDYDIRQPPLEALYPR 513


>tr|A9T077|A9T077_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_138336 PE=4 SV=1
Length = 1876

Score = 110 bits (276), Expect = 3e-23
Identities = 69/160 (43%), Positives = 91/160 (56%), Gaps = 6/160 (3%)
Frame = -3

Query: 511 KVHKPVKATLRLEVERLQMGYFDTEAISEGSRASNGSAE------GGDCYGDMSIDRGHT 350
KV KPVKATLRLE+ERL +T+ ISE +N S + G G + T
Sbjct: 371 KVQKPVKATLRLEIERLGSDDHETDCISECGSFNNYSFDADSHSLGASFSGRSAQGLEST 430

Query: 349 NGVHGIHRGPFNGQTKWLTPDLKDGKAARGFGGSSGSNDFHALDFRNFTRSEPFTQLLHS 170
H H+ +G +D +A G ++F A++FR + EP +QLLH
Sbjct: 431 KTFHNGHQKSNSGH--------RDLQAGIGSSLDLRRSEFRAVEFRLGPKPEPLSQLLHL 482

Query: 169 LYVYPRVASLSRKKNLFIRVELRRDDSDIRKPPLEAIYSR 50
LYVYP+ +L+RK+NLFIR+ELR DD DIRKPPLEA+Y R
Sbjct: 483 LYVYPQSVTLNRKRNLFIRLELRVDDGDIRKPPLEALYPR 522