BP911475
Clone id YMU001_000005_D06
Library
Length 466
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000005_D06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAGACGGCAGGATAACAGGAGCATGGGTTCTTGTATACTCTTGGTTATCTGCTCGTGTTA
TTTCATCCTCTCAGGTCCAGAAAATGTTTCAACCTCAGAGGATTTAAATTCTACACATAG
GGCCTCAAAGAAATTTCAAAAGCATAGACTCTCAAAGCCAGAGTCTGCAAATTATGCTCG
AACTACAAATTTTTCGAGATCAGAGATATTACGAATTGCATCAGAATGGTTTCAAACGCA
GTGACCAAAGGTAAAGATGAGCTCACCTTCGAAGACATTGGAAATATTGAAGAAATGAAG
GCAAACCCCCTTGCCCACCGTATCTTCGAACTGTTTAGTGAAGATGGCAGTGGGCATCTT
ACATTTGATAAGTTTCTGAACATGATGGATGCCTTTTCTGATGATACACCATCCGAGGTG
AAGCTGGTATGGGCTTTTGCCATGTGGGATTATGATGGAGACGGTG
■■Homology search results ■■ -
sp_hit_id Q96Q77
Definition sp|Q96Q77|CIB3_HUMAN Calcium and integrin-binding family member 3 OS=Homo sapiens
Align length 68
Score (bit) 67.4
E-value 3.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911475|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_D06.
(466 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q96Q77|CIB3_HUMAN Calcium and integrin-binding family member ... 67 3e-11
sp|Q568Z7|CIB2_RAT Calcium and integrin-binding family member 2 ... 57 4e-08
sp|Q9Z309|CIB2_MOUSE Calcium and integrin-binding family member ... 57 4e-08
sp|Q9HDE1|CANB_CRYNE Calcineurin subunit B OS=Cryptococcus neofo... 56 7e-08
sp|Q24214|CANB2_DROME Calcineurin subunit B type 2 OS=Drosophila... 56 9e-08
sp|P63100|CANB1_RAT Calcineurin subunit B type 1 OS=Rattus norve... 55 1e-07
sp|Q63810|CANB1_MOUSE Calcineurin subunit B type 1 OS=Mus muscul... 55 1e-07
sp|P63098|CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapie... 55 1e-07
sp|P48451|CANB1_DROME Calcineurin subunit B type 1 OS=Drosophila... 55 1e-07
sp|P63099|CANB1_BOVIN Calcineurin subunit B type 1 OS=Bos taurus... 55 1e-07
sp|Q63811|CANB2_MOUSE Calcineurin subunit B type 2 OS=Mus muscul... 55 2e-07
sp|O75838|CIB2_HUMAN Calcium and integrin-binding family member ... 55 2e-07
sp|Q99828|CIB1_HUMAN Calcium and integrin-binding protein 1 OS=H... 55 2e-07
sp|Q874T7|CANB_KLULA Calcineurin subunit B OS=Kluyveromyces lact... 55 2e-07
sp|Q9UU93|CANB_SCHPO Calcineurin subunit B OS=Schizosaccharomyce... 54 3e-07
sp|P87072|CANB_NEUCR Calcineurin subunit B OS=Neurospora crassa ... 54 3e-07
sp|Q9R010|CIB1_RAT Calcium and integrin-binding protein 1 OS=Rat... 54 4e-07
sp|Q9Z0F4|CIB1_MOUSE Calcium and integrin-binding protein 1 OS=M... 54 4e-07
sp|Q17QE5|CIB1_BOVIN Calcium and integrin-binding protein 1 OS=B... 54 4e-07
sp|P42322|CANB1_NAEGR Calcineurin subunit B OS=Naegleria gruberi... 53 8e-07
sp|Q6BWS8|CANB_DEBHA Calcineurin subunit B OS=Debaryomyces hanse... 52 1e-06
sp|Q96LZ3|CANB2_HUMAN Calcineurin subunit B type 2 OS=Homo sapie... 52 1e-06
sp|Q757B7|CANB_ASHGO Calcineurin subunit B OS=Ashbya gossypii GN... 52 1e-06
sp|Q2TBI5|CANB2_BOVIN Calcineurin subunit B type 2 OS=Bos taurus... 51 2e-06
sp|Q6FLU4|CANB_CANGA Calcineurin subunit B OS=Candida glabrata G... 50 4e-06
sp|P28470|CANB2_RAT Calcineurin subunit B type 2 OS=Rattus norve... 50 5e-06
sp|Q3HRP2|CNBL5_ORYSJ Calcineurin B-like protein 5 OS=Oryza sati... 49 8e-06
sp|Q6CGE6|CANB_YARLI Calcineurin subunit B OS=Yarrowia lipolytic... 49 8e-06
sp|P25296|CANB_YEAST Calcineurin subunit B OS=Saccharomyces cere... 49 1e-05
sp|P36609|NCS2_CAEEL Neuronal calcium sensor 2 OS=Caenorhabditis... 46 9e-05

>sp|Q96Q77|CIB3_HUMAN Calcium and integrin-binding family member 3
OS=Homo sapiens GN=CIB3 PE=2 SV=2
Length = 187

Score = 67.4 bits (163), Expect = 3e-11
Identities = 28/68 (41%), Positives = 46/68 (67%)
Frame = +1

Query: 259 ELTFEDIGNIEEMKANPLAHRIFELFSEDGSGHLTFDKFLNMMDAFSDDTPSEVKLVWAF 438
++ +E IG++ E+K NP RI ++FSEDG GH+T D FL+M S+ P ++K +AF
Sbjct: 53 KVPYELIGSMPELKDNPFRQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPRDLKAYYAF 112

Query: 439 AMWDYDGD 462
++D++ D
Sbjct: 113 KIYDFNND 120


>sp|Q568Z7|CIB2_RAT Calcium and integrin-binding family member 2
OS=Rattus norvegicus GN=Cib2 PE=2 SV=1
Length = 187

Score = 57.0 bits (136), Expect = 4e-08
Identities = 24/57 (42%), Positives = 37/57 (64%)
Frame = +1

Query: 292 EMKANPLAHRIFELFSEDGSGHLTFDKFLNMMDAFSDDTPSEVKLVWAFAMWDYDGD 462
E++ NP RI E FSEDG G+LTF+ F++M + P E+K +AF ++D++ D
Sbjct: 64 ELRENPFKERIVEAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTD 120


>sp|Q9Z309|CIB2_MOUSE Calcium and integrin-binding family member 2
OS=Mus musculus GN=Cib2 PE=2 SV=1
Length = 187

Score = 57.0 bits (136), Expect = 4e-08
Identities = 24/57 (42%), Positives = 37/57 (64%)
Frame = +1

Query: 292 EMKANPLAHRIFELFSEDGSGHLTFDKFLNMMDAFSDDTPSEVKLVWAFAMWDYDGD 462
E++ NP RI E FSEDG G+LTF+ F++M + P E+K +AF ++D++ D
Sbjct: 64 ELRENPFKERIVEAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTD 120


>sp|Q9HDE1|CANB_CRYNE Calcineurin subunit B OS=Cryptococcus
neoformans GN=CNB1 PE=2 SV=1
Length = 175

Score = 56.2 bits (134), Expect = 7e-08
Identities = 27/72 (37%), Positives = 42/72 (58%)
Frame = +1

Query: 250 GKDELTFEDIGNIEEMKANPLAHRIFELFSEDGSGHLTFDKFLNMMDAFSDDTPSEVKLV 429
G + ++ I ++ NPLAHR+ +F EDGSG + F +F+ + AFS + KL
Sbjct: 37 GSGSIDKDEFLQIPQIANNPLAHRMIAIFDEDGSGTVDFQEFVGGLSAFSSKGGRDEKLR 96

Query: 430 WAFAMWDYDGDG 465
+AF ++D D DG
Sbjct: 97 FAFKVYDMDRDG 108


>sp|Q24214|CANB2_DROME Calcineurin subunit B type 2 OS=Drosophila
melanogaster GN=CanB2 PE=1 SV=2
Length = 170

Score = 55.8 bits (133), Expect = 9e-08
Identities = 29/99 (29%), Positives = 52/99 (52%)
Frame = +1

Query: 169 KLCSNYKFFEIRDITNCIRMVSNAVTKGKDELTFEDIGNIEEMKANPLAHRIFELFSEDG 348
++CSN+ EIR + R + L+ ++ ++ E++ NPL R+ ++F DG
Sbjct: 10 EMCSNFDADEIRRLGKRFRKLD---LDNSGALSVDEFMSLPELQQNPLVQRVIDIFDADG 66

Query: 349 SGHLTFDKFLNMMDAFSDDTPSEVKLVWAFAMWDYDGDG 465
+G + F +F+ + FS KL +AF ++D D DG
Sbjct: 67 NGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDG 105


>sp|P63100|CANB1_RAT Calcineurin subunit B type 1 OS=Rattus
norvegicus GN=Ppp3r1 PE=1 SV=2
Length = 170

Score = 55.5 bits (132), Expect = 1e-07
Identities = 28/99 (28%), Positives = 53/99 (53%)
Frame = +1

Query: 169 KLCSNYKFFEIRDITNCIRMVSNAVTKGKDELTFEDIGNIEEMKANPLAHRIFELFSEDG 348
++CS++ EI+ + + + L+ E+ ++ E++ NPL R+ ++F DG
Sbjct: 10 EMCSHFDADEIKRLGKRFKKLD---LDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDG 66

Query: 349 SGHLTFDKFLNMMDAFSDDTPSEVKLVWAFAMWDYDGDG 465
+G + F +F+ + FS E KL +AF ++D D DG
Sbjct: 67 NGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDG 105


>sp|Q63810|CANB1_MOUSE Calcineurin subunit B type 1 OS=Mus musculus
GN=Ppp3r1 PE=1 SV=3
Length = 170

Score = 55.5 bits (132), Expect = 1e-07
Identities = 28/99 (28%), Positives = 53/99 (53%)
Frame = +1

Query: 169 KLCSNYKFFEIRDITNCIRMVSNAVTKGKDELTFEDIGNIEEMKANPLAHRIFELFSEDG 348
++CS++ EI+ + + + L+ E+ ++ E++ NPL R+ ++F DG
Sbjct: 10 EMCSHFDADEIKRLGKRFKKLD---LDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDG 66

Query: 349 SGHLTFDKFLNMMDAFSDDTPSEVKLVWAFAMWDYDGDG 465
+G + F +F+ + FS E KL +AF ++D D DG
Sbjct: 67 NGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDG 105


>sp|P63098|CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens
GN=PPP3R1 PE=1 SV=2
Length = 170

Score = 55.5 bits (132), Expect = 1e-07
Identities = 28/99 (28%), Positives = 53/99 (53%)
Frame = +1

Query: 169 KLCSNYKFFEIRDITNCIRMVSNAVTKGKDELTFEDIGNIEEMKANPLAHRIFELFSEDG 348
++CS++ EI+ + + + L+ E+ ++ E++ NPL R+ ++F DG
Sbjct: 10 EMCSHFDADEIKRLGKRFKKLD---LDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDG 66

Query: 349 SGHLTFDKFLNMMDAFSDDTPSEVKLVWAFAMWDYDGDG 465
+G + F +F+ + FS E KL +AF ++D D DG
Sbjct: 67 NGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDG 105


>sp|P48451|CANB1_DROME Calcineurin subunit B type 1 OS=Drosophila
melanogaster GN=CanB PE=1 SV=1
Length = 170

Score = 55.5 bits (132), Expect = 1e-07
Identities = 29/98 (29%), Positives = 51/98 (52%)
Frame = +1

Query: 172 LCSNYKFFEIRDITNCIRMVSNAVTKGKDELTFEDIGNIEEMKANPLAHRIFELFSEDGS 351
+CSN+ EIR + R + L+ ++ ++ E++ NPL R+ ++F DG+
Sbjct: 11 MCSNFDADEIRRLGKRFRKLD---LDNSGALSIDEFMSLPELQQNPLVQRVIDIFDADGN 67

Query: 352 GHLTFDKFLNMMDAFSDDTPSEVKLVWAFAMWDYDGDG 465
G + F +F+ + FS KL +AF ++D D DG
Sbjct: 68 GEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDG 105


>sp|P63099|CANB1_BOVIN Calcineurin subunit B type 1 OS=Bos taurus
GN=PPP3R1 PE=1 SV=2
Length = 170

Score = 55.5 bits (132), Expect = 1e-07
Identities = 28/99 (28%), Positives = 53/99 (53%)
Frame = +1

Query: 169 KLCSNYKFFEIRDITNCIRMVSNAVTKGKDELTFEDIGNIEEMKANPLAHRIFELFSEDG 348
++CS++ EI+ + + + L+ E+ ++ E++ NPL R+ ++F DG
Sbjct: 10 EMCSHFDADEIKRLGKRFKKLD---LDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDG 66

Query: 349 SGHLTFDKFLNMMDAFSDDTPSEVKLVWAFAMWDYDGDG 465
+G + F +F+ + FS E KL +AF ++D D DG
Sbjct: 67 NGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDG 105


tr_hit_id A9TT21
Definition tr|A9TT21|A9TT21_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 67
Score (bit) 87.0
E-value 4.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911475|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_D06.
(466 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TT21|A9TT21_PHYPA Predicted protein (Fragment) OS=Physcomit... 87 4e-16
tr|Q93640|Q93640_CAEEL Protein F30A10.1, partially confirmed by ... 79 1e-13
tr|B6MLK2|B6MLK2_BRAFL Putative uncharacterized protein OS=Branc... 77 6e-13
tr|A8P593|A8P593_BRUMA Calcium and integrin binding family membe... 74 3e-12
tr|B6MZ00|B6MZ00_BRAFL Putative uncharacterized protein OS=Branc... 70 5e-11
tr|A7SHW4|A7SHW4_NEMVE Predicted protein OS=Nematostella vectens... 69 2e-10
tr|Q6NT26|Q6NT26_HUMAN CIB3 protein (Fragment) OS=Homo sapiens G... 67 3e-10
tr|Q0P523|Q0P523_MOUSE Calcium and integrin binding family membe... 67 6e-10
tr|Q20804|Q20804_CAEEL Protein F55C10.1, partially confirmed by ... 67 6e-10
tr|A8Y4I1|A8Y4I1_CAEBR CBR-CNB-1 protein OS=Caenorhabditis brigg... 67 6e-10
tr|A8WWN1|A8WWN1_CAEBR Putative uncharacterized protein OS=Caeno... 67 6e-10
tr|Q5M8M0|Q5M8M0_XENTR Calcium and integrin binding family membe... 66 8e-10
tr|B4NNJ7|B4NNJ7_DROWI GK23329 OS=Drosophila willistoni GN=GK233... 66 1e-09
tr|Q9W2Q5|Q9W2Q5_DROME CG9236 OS=Drosophila melanogaster GN=CG92... 65 2e-09
tr|Q28ZR4|Q28ZR4_DROPS GA21632 OS=Drosophila pseudoobscura pseud... 65 2e-09
tr|B4GGW3|B4GGW3_DROPE GL17058 OS=Drosophila persimilis GN=GL170... 65 2e-09
tr|B3MIR0|B3MIR0_DROAN GF12205 OS=Drosophila ananassae GN=GF1220... 65 2e-09
tr|Q9NFN1|Q9NFN1_SCHMA Calcineurin B OS=Schistosoma mansoni PE=2... 64 3e-09
tr|Q4SM06|Q4SM06_TETNG Chromosome 13 SCAF14555, whole genome sho... 64 5e-09
tr|B4ME66|B4ME66_DROVI GJ17436 OS=Drosophila virilis GN=GJ17436 ... 64 5e-09
tr|B4KQM6|B4KQM6_DROMO GI19707 OS=Drosophila mojavensis GN=GI197... 64 5e-09
tr|B4J984|B4J984_DROGR GH22004 OS=Drosophila grimshawi GN=GH2200... 64 5e-09
tr|Q7Q4L8|Q7Q4L8_ANOGA AGAP008474-PA OS=Anopheles gambiae GN=AGA... 63 6e-09
tr|Q86H16|Q86H16_SCHJA Calcineurin B OS=Schistosoma japonicum PE... 62 1e-08
tr|B3GV00|B3GV00_SCHJA Putative uncharacterized protein OS=Schis... 62 1e-08
tr|Q6PC72|Q6PC72_DANRE Calcium and integrin binding family membe... 62 1e-08
tr|A7RM01|A7RM01_NEMVE Predicted protein OS=Nematostella vectens... 61 2e-08
tr|A3F4Y4|A3F4Y4_TAEAS Calcineurin B OS=Taenia asiatica PE=2 SV=1 60 4e-08
tr|B6RB21|B6RB21_HALDI Calcineurin B OS=Haliotis discus discus P... 60 7e-08
tr|Q4RWQ7|Q4RWQ7_TETNG Chromosome 15 SCAF14981, whole genome sho... 59 9e-08

>tr|A9TT21|A9TT21_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_38260 PE=4 SV=1
Length = 75

Score = 87.0 bits (214), Expect = 4e-16
Identities = 40/67 (59%), Positives = 48/67 (71%)
Frame = +1

Query: 262 LTFEDIGNIEEMKANPLAHRIFELFSEDGSGHLTFDKFLNMMDAFSDDTPSEVKLVWAFA 441
+ ED IE+M+ NP A RI LFSEDGSG LTF KFLN++ FS T SE+K VW FA
Sbjct: 1 IEIEDFVQIEQMRVNPFAARICLLFSEDGSGRLTFQKFLNVIMVFSKHTSSEIKTVWIFA 60

Query: 442 MWDYDGD 462
+WD+DGD
Sbjct: 61 LWDFDGD 67


>tr|Q93640|Q93640_CAEEL Protein F30A10.1, partially confirmed by
transcript evidence OS=Caenorhabditis elegans
GN=F30A10.1 PE=2 SV=1
Length = 311

Score = 79.0 bits (193), Expect = 1e-13
Identities = 35/67 (52%), Positives = 49/67 (73%)
Frame = +1

Query: 262 LTFEDIGNIEEMKANPLAHRIFELFSEDGSGHLTFDKFLNMMDAFSDDTPSEVKLVWAFA 441
LTFE++ + E+K NP RI E+FSEDG G+L+FD FL+M FS+ P ++KL +AF
Sbjct: 178 LTFEEVEKMPELKENPFKRRICEVFSEDGRGNLSFDDFLDMFSVFSEMAPLQLKLKYAFR 237

Query: 442 MWDYDGD 462
++DYDGD
Sbjct: 238 IYDYDGD 244


>tr|B6MLK2|B6MLK2_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_83937 PE=4 SV=1
Length = 189

Score = 76.6 bits (187), Expect = 6e-13
Identities = 34/68 (50%), Positives = 48/68 (70%)
Frame = +1

Query: 259 ELTFEDIGNIEEMKANPLAHRIFELFSEDGSGHLTFDKFLNMMDAFSDDTPSEVKLVWAF 438
++ FE I + E+K NP RI E+FSEDGSG++TFD FL+M FS+ P ++K V+AF
Sbjct: 55 KVPFEYIEKMPELKENPFRRRICEVFSEDGSGNMTFDDFLDMFSVFSEQAPQDIKAVYAF 114

Query: 439 AMWDYDGD 462
++D DGD
Sbjct: 115 KIYDADGD 122


>tr|A8P593|A8P593_BRUMA Calcium and integrin binding family member
2, putative OS=Brugia malayi GN=Bm1_16785 PE=4 SV=1
Length = 201

Score = 74.3 bits (181), Expect = 3e-12
Identities = 32/67 (47%), Positives = 49/67 (73%)
Frame = +1

Query: 262 LTFEDIGNIEEMKANPLAHRIFELFSEDGSGHLTFDKFLNMMDAFSDDTPSEVKLVWAFA 441
L FE+I + E++ NP RI ++FS+DG+G+LTFD FL+M FS+ P ++KL +AF
Sbjct: 68 LCFEEIEKMPELRENPFRRRICQVFSDDGAGNLTFDDFLDMFSVFSEMAPLQLKLKYAFR 127

Query: 442 MWDYDGD 462
++D+DGD
Sbjct: 128 IYDFDGD 134


>tr|B6MZ00|B6MZ00_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_125227 PE=4 SV=1
Length = 184

Score = 70.1 bits (170), Expect = 5e-11
Identities = 38/94 (40%), Positives = 55/94 (58%)
Frame = +1

Query: 184 YKFFEIRDITNCIRMVSNAVTKGKDELTFEDIGNIEEMKANPLAHRIFELFSEDGSGHLT 363
+K F+I D + +R NA L E I ++ E+K NP RI ++FS G G L+
Sbjct: 31 FKRFQILDPAS-VRANKNA------RLPKERIWSLPELKVNPFKDRICDVFSSSGDGDLS 83

Query: 364 FDKFLNMMDAFSDDTPSEVKLVWAFAMWDYDGDG 465
F+ FL+MM FSD P VK+ +AF ++D+D DG
Sbjct: 84 FEDFLDMMSVFSDSAPKNVKVEYAFKVYDFDSDG 117


>tr|A7SHW4|A7SHW4_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g118898 PE=4 SV=1
Length = 182

Score = 68.6 bits (166), Expect = 2e-10
Identities = 31/59 (52%), Positives = 42/59 (71%)
Frame = +1

Query: 286 IEEMKANPLAHRIFELFSEDGSGHLTFDKFLNMMDAFSDDTPSEVKLVWAFAMWDYDGD 462
+ E+K NP RI ++FS +GSG LTFD FLNMM SD P E+K+ +AF ++D+DGD
Sbjct: 63 LPELKENPFKCRICQVFSVNGSGALTFDDFLNMMSVLSDSAPRELKVKYAFKIFDFDGD 121


>tr|Q6NT26|Q6NT26_HUMAN CIB3 protein (Fragment) OS=Homo sapiens
GN=CIB3 PE=2 SV=1
Length = 180

Score = 67.4 bits (163), Expect = 3e-10
Identities = 28/68 (41%), Positives = 46/68 (67%)
Frame = +1

Query: 259 ELTFEDIGNIEEMKANPLAHRIFELFSEDGSGHLTFDKFLNMMDAFSDDTPSEVKLVWAF 438
++ +E IG++ E+K NP RI ++FSEDG GH+T D FL+M S+ P ++K +AF
Sbjct: 46 KVPYELIGSMPELKDNPFRQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPRDLKAYYAF 105

Query: 439 AMWDYDGD 462
++D++ D
Sbjct: 106 KIYDFNND 113


>tr|Q0P523|Q0P523_MOUSE Calcium and integrin binding family member 3
OS=Mus musculus GN=Cib3 PE=2 SV=1
Length = 160

Score = 66.6 bits (161), Expect = 6e-10
Identities = 28/73 (38%), Positives = 48/73 (65%)
Frame = +1

Query: 244 TKGKDELTFEDIGNIEEMKANPLAHRIFELFSEDGSGHLTFDKFLNMMDAFSDDTPSEVK 423
T K ++ +E IG++ E+K NP RI ++FS+DG GH+T + FL+M S+ P ++K
Sbjct: 21 TSPKVKVPYELIGSMPELKDNPFRQRIAQVFSQDGDGHMTLENFLDMFSVMSEMAPRDLK 80

Query: 424 LVWAFAMWDYDGD 462
+AF ++D++ D
Sbjct: 81 AYYAFKIYDFNND 93


>tr|Q20804|Q20804_CAEEL Protein F55C10.1, partially confirmed by
transcript evidence OS=Caenorhabditis elegans GN=cnb-1
PE=2 SV=3
Length = 171

Score = 66.6 bits (161), Expect = 6e-10
Identities = 31/99 (31%), Positives = 56/99 (56%)
Frame = +1

Query: 169 KLCSNYKFFEIRDITNCIRMVSNAVTKGKDELTFEDIGNIEEMKANPLAHRIFELFSEDG 348
++CSN+ +E+R +T + + G L+ E+ ++ E++ NPL R+ ++F EDG
Sbjct: 10 EMCSNFDAYELRRLTRRFKKLD---VDGSGSLSVEEFMSLPELQQNPLVQRVIDIFDEDG 66

Query: 349 SGHLTFDKFLNMMDAFSDDTPSEVKLVWAFAMWDYDGDG 465
+G + F +F+ + FS KL +AF ++D D DG
Sbjct: 67 NGEVDFREFIQGISQFSVKGDKNTKLKFAFRIYDMDRDG 105


>tr|A8Y4I1|A8Y4I1_CAEBR CBR-CNB-1 protein OS=Caenorhabditis briggsae
GN=Cbr-cnb-1 PE=4 SV=1
Length = 171

Score = 66.6 bits (161), Expect = 6e-10
Identities = 31/99 (31%), Positives = 56/99 (56%)
Frame = +1

Query: 169 KLCSNYKFFEIRDITNCIRMVSNAVTKGKDELTFEDIGNIEEMKANPLAHRIFELFSEDG 348
++CSN+ +E+R +T + + G L+ E+ ++ E++ NPL R+ ++F EDG
Sbjct: 10 EMCSNFDAYELRRLTRRFKKLD---VDGSGSLSVEEFMSLPELQQNPLVQRVIDIFDEDG 66

Query: 349 SGHLTFDKFLNMMDAFSDDTPSEVKLVWAFAMWDYDGDG 465
+G + F +F+ + FS KL +AF ++D D DG
Sbjct: 67 NGEVDFREFIQGISQFSVKGDKNTKLKFAFRIYDMDRDG 105