BP911476
Clone id YMU001_000005_D07
Library
Length 375
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000005_D07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTGAGATATGTACCTGCAGGTACTCGTCCTCAAGGACCTGCTTGAGCTCCAATGTTCTGT
TCGCATCTTCTGCTACAGCAACAGCAATGTTACCTTCGTCTCCTCCAACACCCCGCATTA
CCATACACAGCAGTGCATACGAAACCTGAGATTTGAAGCTGCCGTCATAGAAAAAGCCAA
ATGGGAGTACGTTCCTCTCCGTATTTCGGAGGTTGGGGTGACTTTTGTGCAGATCTAGCC
AGGATAAGTTCACCTCTGTGCGAGGTTATGGCGTAGATACTTTGGTTGGGAAGCGAGCGC
TCAGAGACGAAGAGGTAGCCATGGAAACTCCTGTCTAGTCGACCTCTTCTTTCTGACTTT
CTTCTTCTTCTTCTC
■■Homology search results ■■ -
sp_hit_id Q5DRA4
Definition sp|Q5DRA4|PCDGK_PANTR Protocadherin gamma-C3 OS=Pan troglodytes
Align length 38
Score (bit) 29.6
E-value 4.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911476|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_D07.
(375 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5DRA4|PCDGK_PANTR Protocadherin gamma-C3 OS=Pan troglodytes ... 30 4.9
sp|Q9UN70|PCDGK_HUMAN Protocadherin gamma-C3 OS=Homo sapiens GN=... 30 4.9
sp|Q7PC88|PDR3_ARATH Probable pleiotropic drug resistance protei... 29 6.3
sp|Q91ZC7|MRGA5_MOUSE Mas-related G-protein coupled receptor mem... 29 6.3
sp|Q6CQ49|MED16_KLULA Mediator of RNA polymerase II transcriptio... 29 6.3
sp|Q9IBF7|OTOMP_ONCMY Otolith matrix protein-1 OS=Oncorhynchus m... 29 8.3

>sp|Q5DRA4|PCDGK_PANTR Protocadherin gamma-C3 OS=Pan troglodytes
GN=PCDHGC3 PE=3 SV=1
Length = 934

Score = 29.6 bits (65), Expect = 4.9
Identities = 14/38 (36%), Positives = 21/38 (55%)
Frame = -2

Query: 323 HGYLFVSERSLPNQSIYAITSHRGELILARSAQKSPQP 210
+ +L S PNQS++AI H G++ AR Q + P
Sbjct: 603 NAWLSYSLLGSPNQSLFAIGLHTGQISTARPVQDTDSP 640


>sp|Q9UN70|PCDGK_HUMAN Protocadherin gamma-C3 OS=Homo sapiens
GN=PCDHGC3 PE=1 SV=1
Length = 934

Score = 29.6 bits (65), Expect = 4.9
Identities = 14/38 (36%), Positives = 21/38 (55%)
Frame = -2

Query: 323 HGYLFVSERSLPNQSIYAITSHRGELILARSAQKSPQP 210
+ +L S PNQS++AI H G++ AR Q + P
Sbjct: 603 NAWLSYSLLGSPNQSLFAIGLHTGQISTARPVQDTDSP 640


>sp|Q7PC88|PDR3_ARATH Probable pleiotropic drug resistance protein 3
OS=Arabidopsis thaliana GN=PDR3 PE=2 SV=1
Length = 1426

Score = 29.3 bits (64), Expect = 6.3
Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 9/79 (11%)
Frame = -3

Query: 331 GVSMATSSSLSARFPTKVSTP*PRTEVNLSWLDLHKSHPNLRNTERNVLPFGFFYDGS-- 158
GV +S A + +V+TP + N+ + DL+K R E N+ +GS
Sbjct: 1079 GVPPISSGYNPATWMLEVTTPALEEKYNMEFADLYKKSDQFREVEANIKQLSVPPEGSEP 1138

Query: 157 -------FKSQVSYALLCM 122
++Q+S LLC+
Sbjct: 1139 ISFTSRYSQNQLSQFLLCL 1157


>sp|Q91ZC7|MRGA5_MOUSE Mas-related G-protein coupled receptor member
A5 OS=Mus musculus GN=Mrgpra5 PE=2 SV=2
Length = 304

Score = 29.3 bits (64), Expect = 6.3
Identities = 14/39 (35%), Positives = 23/39 (58%)
Frame = -3

Query: 184 PFGFFYDGSFKSQVSYALLCMVMRGVGGDEGNIAVAVAE 68
P +F++GSF+ Q+ + L MV++ V D IA + E
Sbjct: 258 PIIYFFEGSFRHQLKHQTLKMVLQSVLQDTPEIAENMVE 296


>sp|Q6CQ49|MED16_KLULA Mediator of RNA polymerase II transcription
subunit 16 OS=Kluyveromyces lactis GN=SIN4 PE=3 SV=1
Length = 956

Score = 29.3 bits (64), Expect = 6.3
Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 4/73 (5%)
Frame = -3

Query: 214 NLRNTERNVLPFGFFYDGSFKSQVSYALLCMVMRGVGGDEGNIAVAVA---EDANRTLE- 47
N +T V FFYD F +++LL + V GN+ + A ++ N T E
Sbjct: 75 NGSSTSNGVKQGQFFYDIDFVKWNNWSLLGGELLAVSDSVGNLTILAASLNDEGNTTYES 134

Query: 46 LKQVLEDEYLQVH 8
L + +D +VH
Sbjct: 135 LSMLFQDTIFKVH 147


>sp|Q9IBF7|OTOMP_ONCMY Otolith matrix protein-1 OS=Oncorhynchus
mykiss GN=otomp PE=1 SV=1
Length = 367

Score = 28.9 bits (63), Expect = 8.3
Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 3/69 (4%)
Frame = -3

Query: 262 RTEVNLSWLDLHKS---HPNLRNTERNVLPFGFFYDGSFKSQVSYALLCMVMRGVGGDEG 92
R+ +LS L++H+ HP +R T +P GF + SQ+S C + VG G
Sbjct: 119 RSSSDLSLLEMHERSSCHPRIRTTVGWTVPIGFLVN---TSQISVDEQCNFPKAVGDFFG 175

Query: 91 NIAVAVAED 65
V +D
Sbjct: 176 YSCVPGVKD 184


tr_hit_id B7YLA4
Definition tr|B7YLA4|B7YLA4_VARPD (2Fe-2S)-binding domain protein OS=Variovorax paradoxus S110
Align length 49
Score (bit) 33.1
E-value 7.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911476|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_D07.
(375 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B7YLA4|B7YLA4_VARPD (2Fe-2S)-binding domain protein OS=Variov... 33 7.0
tr|A9P095|A9P095_PICSI Putative uncharacterized protein OS=Picea... 33 7.0

>tr|B7YLA4|B7YLA4_VARPD (2Fe-2S)-binding domain protein
OS=Variovorax paradoxus S110 GN=VaparDRAFT_1879 PE=3
SV=1
Length = 215

Score = 33.1 bits (74), Expect = 7.0
Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 5/49 (10%)
Frame = -1

Query: 243 PG*ICTKVTPTSEIRRGTYSHLAFSMTA-----ASNLRFRMHCCVW*CG 112
PG IC+ V EI+RG SH++ +TA A LR RM + CG
Sbjct: 150 PGQICSAVAVLDEIKRGVPSHVSADLTARPLLSAEELRERMSGNICRCG 198


>tr|A9P095|A9P095_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 225

Score = 33.1 bits (74), Expect = 7.0
Identities = 18/47 (38%), Positives = 23/47 (48%)
Frame = +3

Query: 39 CLSSNVLFASSATATAMLPSSPPTPRITIHSSAYET*DLKLPS*KKP 179
C SS L A T P T + HSSA T +L++PS +KP
Sbjct: 28 CNSSLKLHAPKGRGTVRFPKKQRTSLLRTHSSAIRTRELEMPSIRKP 74