BP911492
Clone id YMU001_000005_F01
Library
Length 374
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000005_F01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTCAGCATCTGGTAGCATCTCTCTTTAGCTGGTAGAGCTCTGGTGGTCGACCAGGTTCTC
CTTTGTTTAGTATGGTTCATTGCTTCATGTTCGATACTTCATGCAGGAGTCATGTCTCAG
CTTTAGACGCTTAGTTAGGAACTTCCTTTGGGGAGGCTCAGAGGGCACTCTTGATACCAG
AGCACCGGCCAGATGGTCTACCATCATCTTTTCTAGGACAGAGGGTGGCTTGGGTATCAT
TGATCCAGAGATATAGAGTAAGGCACTGACTTAGGAACAAGTGTCCCGCCTCACGCAAAC
CTACTAGGCGGGCATGTACATGGCTCGTTACCCAGAAAAGGTACATCTACCTCACATATG
GCCGACACGATCCC
■■Homology search results ■■ -
sp_hit_id O15259
Definition sp|O15259|NPHP1_HUMAN Nephrocystin-1 OS=Homo sapiens
Align length 45
Score (bit) 30.4
E-value 2.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911492|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_F01.
(374 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O15259|NPHP1_HUMAN Nephrocystin-1 OS=Homo sapiens GN=NPHP1 PE... 30 2.8
sp|A5D2S0|IF2_PELTS Translation initiation factor IF-2 OS=Peloto... 30 4.9
sp|P16376|7UP2_DROME Steroid receptor seven-up, isoform A OS=Dro... 30 4.9
sp|P16375|7UP1_DROME Steroid receptor seven-up, isoforms B/C OS=... 30 4.9
sp|P0C2F6|RNHX1_ARATH Putative ribonuclease H protein At1g65750 ... 29 6.3
sp|Q9TU19|NPHP1_CANFA Nephrocystin-1 (Fragment) OS=Canis familia... 29 8.3

>sp|O15259|NPHP1_HUMAN Nephrocystin-1 OS=Homo sapiens GN=NPHP1 PE=1
SV=1
Length = 732

Score = 30.4 bits (67), Expect = 2.8
Identities = 14/45 (31%), Positives = 25/45 (55%)
Frame = +2

Query: 74 GSLLHVRYFMQESCLSFRRLVRNFLWGGSEGTLDTRAPARWSTII 208
G+ YF+Q + + R+ +W +EGT+ +R P+R S I+
Sbjct: 342 GNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSR-PSRISLIL 385


>sp|A5D2S0|IF2_PELTS Translation initiation factor IF-2
OS=Pelotomaculum thermopropionicum (strain DSM 13744 /
JCM 10971 / SI) GN=infB PE=3 SV=1
Length = 973

Score = 29.6 bits (65), Expect = 4.9
Identities = 14/21 (66%), Positives = 15/21 (71%), Gaps = 1/21 (4%)
Frame = -3

Query: 198 DHLAGA-LVSRVPSEPPQRKF 139
DH GA LV RVPS PP R+F
Sbjct: 117 DHYKGAGLVERVPSRPPDRRF 137


>sp|P16376|7UP2_DROME Steroid receptor seven-up, isoform A
OS=Drosophila melanogaster GN=svp PE=2 SV=3
Length = 746

Score = 29.6 bits (65), Expect = 4.9
Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 6/44 (13%)
Frame = +1

Query: 250 DIE*GTDLGTSVPPHANL------LGGHVHGSLPRKGTSTSHMA 363
DI +G VPPH+ LGGH+H + GT+T +A
Sbjct: 26 DIGLSRSMGLGVPPHSAWHEPPASLGGHLHAASAGPGTTTGSVA 69


>sp|P16375|7UP1_DROME Steroid receptor seven-up, isoforms B/C
OS=Drosophila melanogaster GN=svp PE=1 SV=1
Length = 543

Score = 29.6 bits (65), Expect = 4.9
Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 6/44 (13%)
Frame = +1

Query: 250 DIE*GTDLGTSVPPHANL------LGGHVHGSLPRKGTSTSHMA 363
DI +G VPPH+ LGGH+H + GT+T +A
Sbjct: 26 DIGLSRSMGLGVPPHSAWHEPPASLGGHLHAASAGPGTTTGSVA 69


>sp|P0C2F6|RNHX1_ARATH Putative ribonuclease H protein At1g65750
OS=Arabidopsis thaliana GN=At1g65750 PE=3 SV=1
Length = 620

Score = 29.3 bits (64), Expect = 6.3
Identities = 19/57 (33%), Positives = 29/57 (50%)
Frame = +2

Query: 128 RLVRNFLWGGSEGTLDTRAPARWSTIIFSRTEGGLGIIDPEI*SKALT*EQVSRLTQ 298
+L R FLWG S + +WS + + EGGLG+ + ++AL + RL Q
Sbjct: 68 QLSRTFLWG-STAEKKKQHLVKWSKVCSPKKEGGLGVRAAKSMNRALISKVGWRLLQ 123


>sp|Q9TU19|NPHP1_CANFA Nephrocystin-1 (Fragment) OS=Canis familiaris
GN=NPHP1 PE=2 SV=1
Length = 565

Score = 28.9 bits (63), Expect = 8.3
Identities = 16/54 (29%), Positives = 26/54 (48%)
Frame = +2

Query: 47 STRFSFV*YGSLLHVRYFMQESCLSFRRLVRNFLWGGSEGTLDTRAPARWSTII 208
ST F + G+ YF+Q + R+ +W GT+ +R P+R S I+
Sbjct: 166 STLFQLLEEGNQFRASYFLQPELTPSQLAFRDLMWDAKTGTIRSR-PSRVSFIL 218


tr_hit_id A9SSE4
Definition tr|A9SSE4|A9SSE4_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 40
Score (bit) 43.5
E-value 0.005
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911492|Adiantum capillus-veneris mRNA, clone:
YMU001_000005_F01.
(374 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SSE4|A9SSE4_PHYPA Predicted protein OS=Physcomitrella paten... 44 0.005
tr|A9TJ48|A9TJ48_PHYPA Predicted protein OS=Physcomitrella paten... 43 0.009
tr|B8AH48|B8AH48_ORYSI Putative uncharacterized protein OS=Oryza... 42 0.015
tr|A9RCP1|A9RCP1_PHYPA Predicted protein OS=Physcomitrella paten... 42 0.020
tr|B8AA89|B8AA89_ORYSI Putative uncharacterized protein OS=Oryza... 41 0.034
tr|A5B9Y6|A5B9Y6_VITVI Putative uncharacterized protein OS=Vitis... 41 0.034
tr|A2ZUE2|A2ZUE2_ORYSJ Putative uncharacterized protein OS=Oryza... 41 0.034
tr|A5ATU9|A5ATU9_VITVI Putative uncharacterized protein OS=Vitis... 40 0.044
tr|Q94GP2|Q94GP2_ORYSJ Putative reverse transcriptase OS=Oryza s... 40 0.058
tr|B8AJV1|B8AJV1_ORYSI Putative uncharacterized protein OS=Oryza... 40 0.058
tr|A7Q416|A7Q416_VITVI Chromosome chr13 scaffold_48, whole genom... 40 0.058
tr|A3AMM4|A3AMM4_ORYSJ Putative uncharacterized protein OS=Oryza... 40 0.058
tr|A3A6F9|A3A6F9_ORYSJ Putative uncharacterized protein OS=Oryza... 40 0.058
tr|Q53KL9|Q53KL9_ORYSJ Retrotransposon protein, putative, unclas... 39 0.098
tr|A3AZJ4|A3AZJ4_ORYSJ Putative uncharacterized protein OS=Oryza... 39 0.098
tr|A2XZY1|A2XZY1_ORYSI Putative uncharacterized protein OS=Oryza... 39 0.098
tr|A5AX59|A5AX59_VITVI Putative uncharacterized protein OS=Vitis... 39 0.13
tr|Q8S5K1|Q8S5K1_ORYSJ Putative retroelement OS=Oryza sativa sub... 39 0.17
tr|Q33AJ4|Q33AJ4_ORYSJ Retrotransposon protein, putative, unclas... 39 0.17
tr|A5ARC1|A5ARC1_VITVI Putative uncharacterized protein OS=Vitis... 39 0.17
tr|A3C2Y6|A3C2Y6_ORYSJ Putative uncharacterized protein OS=Oryza... 39 0.17
tr|A7R725|A7R725_VITVI Chromosome undetermined scaffold_1537, wh... 38 0.22
tr|A5B650|A5B650_VITVI Putative uncharacterized protein OS=Vitis... 38 0.22
tr|A5ATF6|A5ATF6_VITVI Putative uncharacterized protein OS=Vitis... 38 0.22
tr|Q8H0A5|Q8H0A5_ORYSJ Retrotransposon protein, putative, unclas... 38 0.29
tr|Q7G249|Q7G249_ORYSJ Retrotransposon protein, putative, unclas... 38 0.29
tr|B8BCR5|B8BCR5_ORYSI Putative uncharacterized protein OS=Oryza... 38 0.29
tr|B8BC08|B8BC08_ORYSI Putative uncharacterized protein OS=Oryza... 38 0.29
tr|B8B7F1|B8B7F1_ORYSI Putative uncharacterized protein OS=Oryza... 38 0.29
tr|A5C699|A5C699_VITVI Putative uncharacterized protein OS=Vitis... 38 0.29

>tr|A9SSE4|A9SSE4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_230851 PE=4 SV=1
Length = 209

Score = 43.5 bits (101), Expect = 0.005
Identities = 17/40 (42%), Positives = 24/40 (60%)
Frame = +2

Query: 131 LVRNFLWGGSEGTLDTRAPARWSTIIFSRTEGGLGIIDPE 250
LVRN++W G EG RA W ++I GG+ ++DPE
Sbjct: 21 LVRNYIWSGDEGERKCRAKVAWDSLILPHKLGGIKLLDPE 60


>tr|A9TJ48|A9TJ48_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_93427 PE=4 SV=1
Length = 170

Score = 42.7 bits (99), Expect = 0.009
Identities = 22/53 (41%), Positives = 32/53 (60%)
Frame = +2

Query: 131 LVRNFLWGGSEGTLDTRAPARWSTIIFSRTEGGLGIIDPEI*SKALT*EQVSR 289
++RN+LWGG RA +W TII T+GGL II P ++AL + ++R
Sbjct: 1 MIRNYLWGGITSG-KVRAKVKWDTIIQLMTQGGLKIIGPATKARALLAKLIAR 52


>tr|B8AH48|B8AH48_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_07068 PE=4 SV=1
Length = 766

Score = 42.0 bits (97), Expect = 0.015
Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 3/86 (3%)
Frame = +2

Query: 113 CLSFRRLVRNFLWGGSEGTLDTRAPARWSTIIFSRTEGGLGIIDPEI*SKALT*EQVSRL 292
C RL RNF WG + G + W +I + +GGLG D ++ ++AL Q RL
Sbjct: 557 CEDLNRLTRNFWWGATNGERKIHWRS-WDNLIKPKNQGGLGFRDVKLFNQALLARQAWRL 615

Query: 293 ---TQTY*AGMYMARYPEKVHLPHIW 361
++ + + MA+Y V L W
Sbjct: 616 IDNPESLCSRVLMAKYFPNVSLVDTW 641


>tr|A9RCP1|A9RCP1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_64171 PE=4 SV=1
Length = 985

Score = 41.6 bits (96), Expect = 0.020
Identities = 20/50 (40%), Positives = 31/50 (62%)
Frame = +2

Query: 119 SFRRLVRNFLWGGSEGTLDTRAPARWSTIIFSRTEGGLGIIDPEI*SKAL 268
+ R L RNF+WG G TRA W+ +I + GG+ I+DP++ ++AL
Sbjct: 768 TIRALTRNFIWGAKLGK-KTRAKLSWTLLIQTVASGGVKILDPKLQTQAL 816


>tr|B8AA89|B8AA89_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_02427 PE=4 SV=1
Length = 1477

Score = 40.8 bits (94), Expect = 0.034
Identities = 23/63 (36%), Positives = 32/63 (50%)
Frame = +2

Query: 110 SCLSFRRLVRNFLWGGSEGTLDTRAPARWSTIIFSRTEGGLGIIDPEI*SKALT*EQVSR 289
SC ++ +LVR+F WG E A W ++ + GGLG D I ++AL Q R
Sbjct: 998 SCEAYTKLVRDFWWGDEEDKRKVHWTA-WDNLVLPKCMGGLGFRDVRIFNQALLGRQAWR 1056

Query: 290 LTQ 298
L Q
Sbjct: 1057 LIQ 1059


>tr|A5B9Y6|A5B9Y6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_017106 PE=4 SV=1
Length = 1293

Score = 40.8 bits (94), Expect = 0.034
Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
Frame = +2

Query: 38 LWWSTRFSFV*YGSLLHVRYFMQESCLSFRRLVRNFLWGGSEGTLDTRAP-ARWSTIIFS 214
L WS S Y LL Y ++ L ++ R+FLWGG G L+ R RW+ +
Sbjct: 981 LIWSILSSMPVYFMLLF--YLPRKVRLRLEKIQRDFLWGG--GALEQRPHFVRWNLVCLE 1036

Query: 215 RTEGGLGIIDPEI*SKAL 268
R +GGLG+ + + +KAL
Sbjct: 1037 RKKGGLGVRNLALMNKAL 1054


>tr|A2ZUE2|A2ZUE2_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_002164 PE=4 SV=1
Length = 1339

Score = 40.8 bits (94), Expect = 0.034
Identities = 23/63 (36%), Positives = 32/63 (50%)
Frame = +2

Query: 110 SCLSFRRLVRNFLWGGSEGTLDTRAPARWSTIIFSRTEGGLGIIDPEI*SKALT*EQVSR 289
SC ++ +LVR+F WG E A W ++ + GGLG D I ++AL Q R
Sbjct: 860 SCEAYTKLVRDFWWGDEEDKRKVHWTA-WDNLVLPKCMGGLGFRDVRIFNQALLGRQAWR 918

Query: 290 LTQ 298
L Q
Sbjct: 919 LIQ 921


>tr|A5ATU9|A5ATU9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_017965 PE=4 SV=1
Length = 411

Score = 40.4 bits (93), Expect = 0.044
Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
Frame = +2

Query: 116 LSFRRLVRNFLWGGSEGTLDTRAP-ARWSTIIFSRTEGGLGIIDPEI*SKAL 268
L R+ R+FLWGG G LD R RW+T+ + +GGLG+ + +KAL
Sbjct: 294 LMLERIQRDFLWGG--GALDRRPRLVRWATMCLDKRKGGLGVKSFSLLNKAL 343


>tr|Q94GP2|Q94GP2_ORYSJ Putative reverse transcriptase OS=Oryza
sativa subsp. japonica GN=OJ1124_H03.8 PE=4 SV=2
Length = 1833

Score = 40.0 bits (92), Expect = 0.058
Identities = 22/60 (36%), Positives = 31/60 (51%)
Frame = +2

Query: 113 CLSFRRLVRNFLWGGSEGTLDTRAPARWSTIIFSRTEGGLGIIDPEI*SKALT*EQVSRL 292
C + R+VRNF WG G A W I++ ++ GGLG D + ++AL Q RL
Sbjct: 727 CDDYTRMVRNFWWGHDNGERKVHWIA-WEKILYPKSHGGLGFRDMKCFNQALLARQAWRL 785


>tr|B8AJV1|B8AJV1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_13484 PE=4 SV=1
Length = 1874

Score = 40.0 bits (92), Expect = 0.058
Identities = 22/60 (36%), Positives = 31/60 (51%)
Frame = +2

Query: 113 CLSFRRLVRNFLWGGSEGTLDTRAPARWSTIIFSRTEGGLGIIDPEI*SKALT*EQVSRL 292
C + R+VRNF WG G A W I++ ++ GGLG D + ++AL Q RL
Sbjct: 702 CDDYTRMVRNFWWGHDNGERKVHWIA-WEKILYPKSHGGLGFRDMKCFNQALLARQAWRL 760