BP911532
Clone id YMU001_000006_A09
Library
Length 518
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000006_A09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGGACAGACATTGAATCCACTTGATCACTCCACCCCGTTTCTAGTCGTATGCAATCATCT
GCTTCATGTAGAATCTCTTTTGTAAGCTTTCCCTTTTTAGCCAATTCCATGACATTTGGC
CAAAGTCGACCATGATGATCACTCACCTCTTCATCACTAAGATACTCAATTTTGACTCCA
TAAGTAGCTGCCTCATTTGAAGAGGTGGCATGGTTAGTTTCCATATCCTCAACTAAGGTT
TGCATTCCCCATTTCCCAAAGTTAGTTCTCAAGGGTAGACCTGTATCTCTAAAGTGGATT
TTTACCATCCTTAAAAAAGACAGCATCTTTTGTCAAAGCATCACTAAAACCATCACAAAC
CGTTCTTACATGGTCTGTACTGTCACACCAAATACATCTATAAACAAACCCTCCTTCGGG
TTGTTGTCTTTGCCTAGGAATTGGCCCTGATGGTTGGCCTTTTTCTTCAAGCTTTGCAAG
TTTCACCTTCAAGTCACGCATTCCCTTCACAAGCTCAT
■■Homology search results ■■ -
sp_hit_id Q6PIF6
Definition sp|Q6PIF6|MYO7B_HUMAN Myosin-VIIb OS=Homo sapiens
Align length 65
Score (bit) 31.6
E-value 2.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911532|Adiantum capillus-veneris mRNA, clone:
YMU001_000006_A09.
(518 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6PIF6|MYO7B_HUMAN Myosin-VIIb OS=Homo sapiens GN=MYO7B PE=2 ... 32 2.3
sp|Q32RQ7|CLPP_ZYGCR ATP-dependent Clp protease proteolytic subu... 30 5.2
sp|P71000|YWHH_BACSU Uncharacterized protein ywhH OS=Bacillus su... 30 6.8
sp|Q12381|PRP1_SCHPO Pre-mRNA-splicing factor prp1 OS=Schizosacc... 30 8.8

>sp|Q6PIF6|MYO7B_HUMAN Myosin-VIIb OS=Homo sapiens GN=MYO7B PE=2
SV=2
Length = 2116

Score = 31.6 bits (70), Expect = 2.3
Identities = 23/65 (35%), Positives = 29/65 (44%)
Frame = -1

Query: 224 METNHATSSNEAATYGVKIEYLSDEEVSDHHGRLWPNVMELAKKGKLTKEILHEADDCIR 45
MET H S G I Y + EE S G L PN M + +GKL + L D +R
Sbjct: 681 METVHIRKS------GFPIRY-TFEEFSQRFGVLLPNAMRMQLQGKLRQMTLGITDVWLR 733

Query: 44 LETGW 30
+ W
Sbjct: 734 TDKDW 738


>sp|Q32RQ7|CLPP_ZYGCR ATP-dependent Clp protease proteolytic subunit
OS=Zygnema circumcarinatum GN=clpP PE=3 SV=1
Length = 211

Score = 30.4 bits (67), Expect = 5.2
Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 4/67 (5%)
Frame = -1

Query: 308 MVKIHFRDTGLPLRTNFGKWGMQTLVEDMETNHATSSNEAATYGVKIEYLSDEEVSDH-- 135
+ K++ + TG P M + EDME + S+ EA YG+ +D+E S +
Sbjct: 154 VTKVYMQRTGKP---------MAVISEDMERDVFMSAKEAQAYGIVDLVATDDEPSTNTP 204

Query: 134 --HGRLW 120
+GR W
Sbjct: 205 FDYGRKW 211


>sp|P71000|YWHH_BACSU Uncharacterized protein ywhH OS=Bacillus
subtilis GN=ywhH PE=4 SV=1
Length = 157

Score = 30.0 bits (66), Expect = 6.8
Identities = 13/39 (33%), Positives = 22/39 (56%)
Frame = -1

Query: 272 LRTNFGKWGMQTLVEDMETNHATSSNEAATYGVKIEYLS 156
+RT+F +W + V + ET+ AT A T GV + ++
Sbjct: 6 VRTHFTQWNRENDVTEFETSSATVEQAAETIGVSLSRIA 44


>sp|Q12381|PRP1_SCHPO Pre-mRNA-splicing factor prp1
OS=Schizosaccharomyces pombe GN=prp1 PE=1 SV=1
Length = 906

Score = 29.6 bits (65), Expect = 8.8
Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
Frame = -1

Query: 200 SNEAATYGVKIEYLSDEEVSD-HHGRLWPNVMELAKKGKLT-KEILHEA 60
S EA + E L+ E +D HHG WP++ + K + T +E+LH A
Sbjct: 854 SLEAGNEDQQKEVLTSFETADPHHGYFWPSITKDIKNSRKTPQELLHLA 902


tr_hit_id A9TW93
Definition tr|A9TW93|A9TW93_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 71
Score (bit) 88.6
E-value 5.0e-28
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911532|Adiantum capillus-veneris mRNA, clone:
YMU001_000006_A09.
(518 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TW93|A9TW93_PHYPA Predicted protein OS=Physcomitrella paten... 89 5e-28
tr|A9RCF3|A9RCF3_PHYPA Predicted protein OS=Physcomitrella paten... 75 4e-27
tr|A9TCS9|A9TCS9_PHYPA Predicted protein OS=Physcomitrella paten... 87 7e-27
tr|A9TC30|A9TC30_PHYPA Predicted protein OS=Physcomitrella paten... 84 4e-26
tr|A9SBL6|A9SBL6_PHYPA Predicted protein OS=Physcomitrella paten... 72 5e-26
tr|A9TXN8|A9TXN8_PHYPA Predicted protein OS=Physcomitrella paten... 74 2e-25
tr|A9STR6|A9STR6_PHYPA Predicted protein OS=Physcomitrella paten... 82 8e-25
tr|A9TU52|A9TU52_PHYPA Predicted protein OS=Physcomitrella paten... 74 1e-24
tr|A9T6M0|A9T6M0_PHYPA Predicted protein OS=Physcomitrella paten... 72 1e-24
tr|A9RYE5|A9RYE5_PHYPA Predicted protein OS=Physcomitrella paten... 72 1e-24
tr|A9SN43|A9SN43_PHYPA Predicted protein OS=Physcomitrella paten... 70 3e-24
tr|A9U4Z3|A9U4Z3_PHYPA Predicted protein OS=Physcomitrella paten... 68 4e-24
tr|A9S3S2|A9S3S2_PHYPA Predicted protein OS=Physcomitrella paten... 70 4e-24
tr|A9SRG5|A9SRG5_PHYPA Predicted protein OS=Physcomitrella paten... 92 4e-24
tr|A9U4X4|A9U4X4_PHYPA Predicted protein OS=Physcomitrella paten... 68 4e-24
tr|A9TWE9|A9TWE9_PHYPA Predicted protein OS=Physcomitrella paten... 68 5e-24
tr|A9U665|A9U665_PHYPA Predicted protein OS=Physcomitrella paten... 67 5e-24
tr|A9T8D7|A9T8D7_PHYPA Predicted protein OS=Physcomitrella paten... 69 5e-24
tr|A9T9L9|A9T9L9_PHYPA Predicted protein OS=Physcomitrella paten... 69 5e-24
tr|A9S1U2|A9S1U2_PHYPA Predicted protein OS=Physcomitrella paten... 67 6e-24
tr|A9TLN1|A9TLN1_PHYPA Predicted protein OS=Physcomitrella paten... 70 6e-24
tr|A9SXK2|A9SXK2_PHYPA Predicted protein OS=Physcomitrella paten... 70 6e-24
tr|A9T0C7|A9T0C7_PHYPA Predicted protein OS=Physcomitrella paten... 67 6e-24
tr|A9TNX1|A9TNX1_PHYPA Predicted protein OS=Physcomitrella paten... 69 6e-24
tr|A9RB92|A9RB92_PHYPA Predicted protein OS=Physcomitrella paten... 70 8e-24
tr|A9RMR3|A9RMR3_PHYPA Predicted protein OS=Physcomitrella paten... 69 8e-24
tr|A9U286|A9U286_PHYPA Predicted protein OS=Physcomitrella paten... 69 8e-24
tr|A9RWA1|A9RWA1_PHYPA Predicted protein OS=Physcomitrella paten... 69 8e-24
tr|A9TRF3|A9TRF3_PHYPA Predicted protein OS=Physcomitrella paten... 67 1e-23
tr|A9TWC7|A9TWC7_PHYPA Predicted protein OS=Physcomitrella paten... 69 1e-23

>tr|A9TW93|A9TW93_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_98120 PE=4 SV=1
Length = 560

Score = 88.6 bits (218), Expect(2) = 5e-28
Identities = 40/71 (56%), Positives = 51/71 (71%)
Frame = -3

Query: 516 ELVKGMRDLKVKLAKLEEKGQPSGPIPRQRQQPEGGFVYRCIWCDSTDHVRTVCDGFSDA 337
E+++GMRDL++K AKLEEKGQ S +QR +P G V+RC+WCDS DH R C+ F +
Sbjct: 265 EIIRGMRDLQIKFAKLEEKGQSSRISTKQRPRPMEGVVHRCMWCDSIDHSRKECEEFIEK 324

Query: 336 LTKDAVFFKDG 304
L K VFFKDG
Sbjct: 325 LRKRVVFFKDG 335



Score = 59.7 bits (143), Expect(2) = 5e-28
Identities = 35/105 (33%), Positives = 52/105 (49%), Gaps = 4/105 (3%)
Frame = -1

Query: 317 FLRMVKIHFRDTGLPLRTNFGKWGMQTLVEDMETNHATSSNEAATYGVKIE----YLSDE 150
F + IH ++ G L TNFGK GM+ + D SSNEA+TY V+ + +
Sbjct: 331 FFKDGMIHSKENGEKLETNFGKGGMKLFIGDTFKVQTISSNEASTYWVEADPNRCLSINL 390

Query: 149 EVSDHHGRLWPNVMELAKKGKLTKEILHEADDCIRLETGWSDQVD 15
E LW + M+ A++ T++ L + IR TGW D +D
Sbjct: 391 EFPIESNSLWTSAMKYAERENFTRDDLKRVGNNIRQITGWDDPID 435


>tr|A9RCF3|A9RCF3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_64503 PE=4 SV=1
Length = 643

Score = 74.7 bits (182), Expect(2) = 4e-27
Identities = 34/72 (47%), Positives = 47/72 (65%)
Frame = -3

Query: 516 ELVKGMRDLKVKLAKLEEKGQPSGPIPRQRQQPEGGFVYRCIWCDSTDHVRTVCDGFSDA 337
ELVKGM+D ++KLAKLEEK + +P + + G++ RCIWCDS +H R C F D
Sbjct: 149 ELVKGMKDFQIKLAKLEEKER----LPESKSVSKPGYIQRCIWCDSMEHPRRECGDFIDI 204

Query: 336 LTKDAVFFKDGK 301
L + + +KDGK
Sbjct: 205 LRQGVILWKDGK 216



Score = 70.5 bits (171), Expect(2) = 4e-27
Identities = 41/103 (39%), Positives = 59/103 (57%), Gaps = 3/103 (2%)
Frame = -1

Query: 302 KIHFRDTGLPLRTNFGKWGMQTLVEDMETNHATSSNEAATYGVKIEYLSDEEVSDHH--- 132
KI RDTG L+TNFGK GM+ ++E+ + A +S +A TYG++ E+V D +
Sbjct: 216 KIALRDTGEFLKTNFGKGGMKKVLEEHLSQQARASRKAITYGIE-AIREKEDVFDKYINT 274

Query: 131 GRLWPNVMELAKKGKLTKEILHEADDCIRLETGWSDQVDSMSV 3
G LW + KGK T++ L IR TGW D +D+MS+
Sbjct: 275 GDLWNYAIISMNKGKTTRQELLNTATIIRNATGWDDPIDTMSI 317


>tr|A9TCS9|A9TCS9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_91078 PE=4 SV=1
Length = 373

Score = 87.0 bits (214), Expect(2) = 7e-27
Identities = 38/71 (53%), Positives = 52/71 (73%)
Frame = -3

Query: 516 ELVKGMRDLKVKLAKLEEKGQPSGPIPRQRQQPEGGFVYRCIWCDSTDHVRTVCDGFSDA 337
E+++GMRDL++K AKLEEKGQ S +QR +P G V+RC+WCD+ DH+R C+ ++
Sbjct: 183 EIIRGMRDLQIKFAKLEEKGQSSRISIKQRPRPMAGVVHRCMWCDNIDHLRRECEECTEI 242

Query: 336 LTKDAVFFKDG 304
L K VFFKDG
Sbjct: 243 LRKGVVFFKDG 253



Score = 57.4 bits (137), Expect(2) = 7e-27
Identities = 36/103 (34%), Positives = 51/103 (49%), Gaps = 4/103 (3%)
Frame = -1

Query: 299 IHFRDTGLPLRTNFGKWGMQTLVEDMETNHATSSNEAATYGVKIE----YLSDEEVSDHH 132
IH ++ G L TNFGK GM+ + SSNEA+TY V+ + + E
Sbjct: 255 IHSKENGEKLETNFGKGGMKLFIVYTFKVQTISSNEASTYWVEADPSRCLSINLEFLVES 314

Query: 131 GRLWPNVMELAKKGKLTKEILHEADDCIRLETGWSDQVDSMSV 3
LW + M AK+ T++ L + IR T W+D VD +SV
Sbjct: 315 SSLWTSAMRYAKRENFTRDDLKRIGNNIRQITRWNDPVDRLSV 357


>tr|A9TC30|A9TC30_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_90813 PE=4 SV=1
Length = 423

Score = 84.0 bits (206), Expect(2) = 4e-26
Identities = 37/71 (52%), Positives = 51/71 (71%)
Frame = -3

Query: 516 ELVKGMRDLKVKLAKLEEKGQPSGPIPRQRQQPEGGFVYRCIWCDSTDHVRTVCDGFSDA 337
E+++GMRDL++K AKLEEKGQ +Q+ + G V+RC+WCD+ DH R C+ F++A
Sbjct: 179 EIIRGMRDLQIKFAKLEEKGQSPRISTKQKPRLMEGVVHRCMWCDNIDHSRRECEEFTEA 238

Query: 336 LTKDAVFFKDG 304
L K VFFKDG
Sbjct: 239 LCKGVVFFKDG 249



Score = 57.8 bits (138), Expect(2) = 4e-26
Identities = 35/109 (32%), Positives = 52/109 (47%), Gaps = 4/109 (3%)
Frame = -1

Query: 317 FLRMVKIHFRDTGLPLRTNFGKWGMQTLVEDMETNHATSSNEAATYGVKIE----YLSDE 150
F + +H ++ G L TNFGK GM+ + D SSNEA+TY V+ + +
Sbjct: 245 FFKDGMMHSKENGEKLETNFGKGGMKLFIGDTFKVQTISSNEASTYWVEADTRRCLSINL 304

Query: 149 EVSDHHGRLWPNVMELAKKGKLTKEILHEADDCIRLETGWSDQVDSMSV 3
E LW + M ++ T++ L + IR GW D VD +SV
Sbjct: 305 EFPIESSSLWTSAMRYIERRNFTRDDLKHVGNNIRKIIGWDDPVDRLSV 353


>tr|A9SBL6|A9SBL6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_77158 PE=4 SV=1
Length = 718

Score = 72.0 bits (175), Expect(2) = 5e-26
Identities = 34/72 (47%), Positives = 47/72 (65%)
Frame = -3

Query: 516 ELVKGMRDLKVKLAKLEEKGQPSGPIPRQRQQPEGGFVYRCIWCDSTDHVRTVCDGFSDA 337
ELVKGM+DL++KLAKLEEK + +P + + ++ RCIWCDS +H R C F D
Sbjct: 217 ELVKGMKDLQIKLAKLEEKER----LPESKSVLKPRYIQRCIWCDSMEHPRRKCGDFIDI 272

Query: 336 LTKDAVFFKDGK 301
L + + +KDGK
Sbjct: 273 LRQRVILWKDGK 284



Score = 69.3 bits (168), Expect(2) = 5e-26
Identities = 44/103 (42%), Positives = 57/103 (55%), Gaps = 3/103 (2%)
Frame = -1

Query: 302 KIHFRDTGLPLRTNFGKWGMQTLVEDMETNHATSSNEAATYGVKIEYLSDEEVSDHH--- 132
KI FRDTG L+TNFGK GMQ + E+ + A +S EA TY ++ E+V D +
Sbjct: 284 KIAFRDTGEFLKTNFGKRGMQKVFEEHLSQQAMASREAITYSIE-AVREKEDVFDKYINI 342

Query: 131 GRLWPNVMELAKKGKLTKEILHEADDCIRLETGWSDQVDSMSV 3
LW + + K K+TK L IR TGW D VD+MSV
Sbjct: 343 EDLWNHAIISMNKEKITKHELLNKATIIRNATGWDDPVDTMSV 385


>tr|A9TXN8|A9TXN8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_98656 PE=4 SV=1
Length = 697

Score = 74.3 bits (181), Expect(2) = 2e-25
Identities = 39/102 (38%), Positives = 60/102 (58%), Gaps = 2/102 (1%)
Frame = -1

Query: 302 KIHFRDTGLPLRTNFGKWGMQTLVEDMETNHATSSNEAATYGVKIEYLSDEEV--SDHHG 129
KI +D L+TNFGK GM+ LV+D H T++ E+A+YG ++ D+E+ S
Sbjct: 283 KIALKDREDLLQTNFGKGGMRALVQDYLKEHETAARESASYGARV----DDEIGGSTETS 338

Query: 128 RLWPNVMELAKKGKLTKEILHEADDCIRLETGWSDQVDSMSV 3
WP+ + ++GKL +E+L +R TGW D V+S+SV
Sbjct: 339 EFWPSAVSTMQEGKLPREVLLRTAATLRGRTGWEDPVESLSV 380



Score = 65.1 bits (157), Expect(2) = 2e-25
Identities = 30/72 (41%), Positives = 45/72 (62%)
Frame = -3

Query: 516 ELVKGMRDLKVKLAKLEEKGQPSGPIPRQRQQPEGGFVYRCIWCDSTDHVRTVCDGFSDA 337
E+++GMRDL++KLA+LEE + +Q G+V RCIWCD H R VC+ F++
Sbjct: 216 EIIRGMRDLQIKLARLEENTSTNNSKNVSKQ----GYVQRCIWCDVASHTRKVCNEFNNM 271

Query: 336 LTKDAVFFKDGK 301
+ + +KDGK
Sbjct: 272 IWQGITCWKDGK 283


>tr|A9STR6|A9STR6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_83884 PE=4 SV=1
Length = 296

Score = 82.4 bits (202), Expect(2) = 8e-25
Identities = 37/71 (52%), Positives = 48/71 (67%)
Frame = -3

Query: 516 ELVKGMRDLKVKLAKLEEKGQPSGPIPRQRQQPEGGFVYRCIWCDSTDHVRTVCDGFSDA 337
E++ GMRDL++K AKLEEK Q S +QR P G ++RC+WCDS DH + C F++A
Sbjct: 106 EIIHGMRDLQIKFAKLEEKDQSSRISTKQRPGPIEGVIHRCMWCDSIDHSKKECKDFTEA 165

Query: 336 LTKDAVFFKDG 304
L K FFKDG
Sbjct: 166 LRKGVFFFKDG 176



Score = 55.1 bits (131), Expect(2) = 8e-25
Identities = 34/109 (31%), Positives = 52/109 (47%), Gaps = 4/109 (3%)
Frame = -1

Query: 317 FLRMVKIHFRDTGLPLRTNFGKWGMQTLVEDMETNHATSSNEAATYGVKIE----YLSDE 150
F + IH +++G L TNF K GM+ + D H S NEA+TY V+ + +
Sbjct: 172 FFKDGMIHSKESGEKLETNFSKGGMKLFIGDTFKVHTISRNEASTYWVEADPSRCLSINL 231

Query: 149 EVSDHHGRLWPNVMELAKKGKLTKEILHEADDCIRLETGWSDQVDSMSV 3
+ LW + M ++ LT++ L + IR TGW D V + V
Sbjct: 232 KFPGESNSLWTSAMSYGERKNLTRDDLKCVGNNIRQITGWDDPVHRLFV 280


>tr|A9TU52|A9TU52_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_97310 PE=4 SV=1
Length = 1223

Score = 73.6 bits (179), Expect(2) = 1e-24
Identities = 33/72 (45%), Positives = 48/72 (66%)
Frame = -3

Query: 516 ELVKGMRDLKVKLAKLEEKGQPSGPIPRQRQQPEGGFVYRCIWCDSTDHVRTVCDGFSDA 337
ELVKGM+DL++KLAKLE+K + +P + + G++ RCIWCDS +H R C F +
Sbjct: 562 ELVKGMKDLQIKLAKLEDKER----LPENKSISKSGYILRCIWCDSMEHPRRKCGDFVNI 617

Query: 336 LTKDAVFFKDGK 301
L + + +KDGK
Sbjct: 618 LQQGVILWKDGK 629



Score = 63.5 bits (153), Expect(2) = 1e-24
Identities = 39/103 (37%), Positives = 57/103 (55%), Gaps = 3/103 (2%)
Frame = -1

Query: 302 KIHFRDTGLPLRTNFGKWGMQTLVEDMETNHATSSNEAATYGVKIEYLSDEEVSDHH--- 132
KI RDTG L+TNFGK GM+ ++E+ + A +S EA YG++ E+V D +
Sbjct: 629 KIALRDTGEFLKTNFGKGGMKKVLEEHISQQAMASREAIIYGIE-AIREKEDVFDKYINT 687

Query: 131 GRLWPNVMELAKKGKLTKEILHEADDCIRLETGWSDQVDSMSV 3
LW + + K K+TK+ L IR GW D VD++S+
Sbjct: 688 RDLWNHAIISMNKRKITKQELLNTATIIRNAIGWDDPVDTISI 730


>tr|A9T6M0|A9T6M0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_88773 PE=4 SV=1
Length = 552

Score = 71.6 bits (174), Expect(2) = 1e-24
Identities = 38/100 (38%), Positives = 57/100 (57%)
Frame = -1

Query: 302 KIHFRDTGLPLRTNFGKWGMQTLVEDMETNHATSSNEAATYGVKIEYLSDEEVSDHHGRL 123
KI +D L+TNFGK GM+ LV+D H T++ E+A+YG +++ D S
Sbjct: 345 KIALKDREDLLQTNFGKGGMRALVQDYLKEHETTARESASYGARVD--DDLGRSTETSEF 402

Query: 122 WPNVMELAKKGKLTKEILHEADDCIRLETGWSDQVDSMSV 3
W + + ++GKL +E L + IR TGW D V+S+SV
Sbjct: 403 WASAVSTMQEGKLPREALLKTAATIRRRTGWEDSVESLSV 442



Score = 65.5 bits (158), Expect(2) = 1e-24
Identities = 30/72 (41%), Positives = 45/72 (62%)
Frame = -3

Query: 516 ELVKGMRDLKVKLAKLEEKGQPSGPIPRQRQQPEGGFVYRCIWCDSTDHVRTVCDGFSDA 337
E+++GMRDL++KLAKLEE + +Q G+V RCIWCD H R C+ F++
Sbjct: 278 EIIRGMRDLQIKLAKLEENTSTNNSKNVSKQ----GYVQRCIWCDDASHTRKDCNEFNNM 333

Query: 336 LTKDAVFFKDGK 301
+ + + +KDGK
Sbjct: 334 IWQGIICWKDGK 345


>tr|A9RYE5|A9RYE5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_72178 PE=4 SV=1
Length = 599

Score = 71.6 bits (174), Expect(2) = 1e-24
Identities = 39/100 (39%), Positives = 58/100 (58%)
Frame = -1

Query: 302 KIHFRDTGLPLRTNFGKWGMQTLVEDMETNHATSSNEAATYGVKIEYLSDEEVSDHHGRL 123
KI +D L+TNFGK GM+ LV+D H T++ E+A+YG ++ D S
Sbjct: 223 KIALKDRKDLLQTNFGKEGMRALVQDYLKEHETAARESASYGTRVG--DDLGGSTETNEF 280

Query: 122 WPNVMELAKKGKLTKEILHEADDCIRLETGWSDQVDSMSV 3
W + + + ++GKL +E L + IR ETGW D V+S+SV
Sbjct: 281 WASAISIMQEGKLPREALLKTTAIIRGETGWEDPVESVSV 320



Score = 65.1 bits (157), Expect(2) = 1e-24
Identities = 29/72 (40%), Positives = 45/72 (62%)
Frame = -3

Query: 516 ELVKGMRDLKVKLAKLEEKGQPSGPIPRQRQQPEGGFVYRCIWCDSTDHVRTVCDGFSDA 337
E+++GMRDL++KLA+LEE I + + G+V RCIWCD H R C+ F++
Sbjct: 156 EIIRGMRDLQIKLARLEENTS----INNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNM 211

Query: 336 LTKDAVFFKDGK 301
+ + + +KDGK
Sbjct: 212 IWQGIICWKDGK 223