BP911567
Clone id YMU001_000006_E02
Library
Length 369
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000006_E02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTTATATTTACCTCAGGCCGATCCAAACATACAGGGCAGCCAGCATCGCTCGCAGCGCTT
GGAAAACCATTCTAATATCAACTATGCTTTCGACCCTGGGCCCCAAGCCACCTAAATGGC
AGTACGAAAGCTCGAGGAAGGCATCTGCTCATGGCCTTAGAACAATACAACAGTATGAGC
AGCAGAGGCGCTCAGGCATGCATTATCGTATATCAATTTGTTGACTATGCCGCCGAGTAG
ACATCTCCAAAAACAGAGGCAACATTGTCAGCACCCTGCACTTGACGTCCACATCCGTCT
CCCACCAAACAATAACCTGCTACAAGCCTAAGAGGCTAACAAACTGTTGGTGGGTGATAC
CAGTGATTG
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911567|Adiantum capillus-veneris mRNA, clone:
YMU001_000006_E02.
(369 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id Q29F78
Definition tr|Q29F78|Q29F78_DROPS GA16811 OS=Drosophila pseudoobscura pseudoobscura
Align length 61
Score (bit) 35.4
E-value 1.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911567|Adiantum capillus-veneris mRNA, clone:
YMU001_000006_E02.
(369 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q29F78|Q29F78_DROPS GA16811 OS=Drosophila pseudoobscura pseud... 35 1.4
tr|B4HA71|B4HA71_DROPE GL18435 OS=Drosophila persimilis GN=GL184... 35 1.4
tr|Q0EVS5|Q0EVS5_9PROT Dimethyladenosine transferase OS=Mariprof... 33 9.3
tr|A8N2K5|A8N2K5_COPC7 Putative uncharacterized protein OS=Copri... 33 9.3

>tr|Q29F78|Q29F78_DROPS GA16811 OS=Drosophila pseudoobscura
pseudoobscura GN=GA16811 PE=4 SV=2
Length = 1811

Score = 35.4 bits (80), Expect = 1.4
Identities = 19/61 (31%), Positives = 31/61 (50%)
Frame = +3

Query: 3 YIYLRPIQTYRAASIARSAWKTILISTMLSTLGPKPPKWQYESSRKASAHGLRTIQQYEQ 182
Y+ L P+++ AA+ A + + I IS + T P PP SS ++ H + Q +Q
Sbjct: 941 YLPLEPLESNAAATPAANTTEVITISDAMETSNPPPPATILVSSEASTEHEQMDVVQQQQ 1000

Query: 183 Q 185
Q
Sbjct: 1001 Q 1001


>tr|B4HA71|B4HA71_DROPE GL18435 OS=Drosophila persimilis GN=GL18435
PE=4 SV=1
Length = 1790

Score = 35.4 bits (80), Expect = 1.4
Identities = 19/61 (31%), Positives = 31/61 (50%)
Frame = +3

Query: 3 YIYLRPIQTYRAASIARSAWKTILISTMLSTLGPKPPKWQYESSRKASAHGLRTIQQYEQ 182
Y+ L P+++ AA+ A + + I IS + T P PP SS ++ H + Q +Q
Sbjct: 918 YLPLEPLESNAAATPAANTTEVITISDAMETSNPPPPATILVSSEASTEHEQMDVVQQQQ 977

Query: 183 Q 185
Q
Sbjct: 978 Q 978


>tr|Q0EVS5|Q0EVS5_9PROT Dimethyladenosine transferase
OS=Mariprofundus ferrooxydans PV-1 GN=ksgA PE=4 SV=1
Length = 265

Score = 32.7 bits (73), Expect = 9.3
Identities = 20/64 (31%), Positives = 28/64 (43%)
Frame = +2

Query: 116 MAVRKLEEGICSWP*NNTTV*AAEALRHALSYINLLTMPPSRHLQKQRQHCQHPALDVHI 295
M R++ E IC+ P + T + +RH LLT+PP + H L H
Sbjct: 139 MYQREVAERICAGPGSKTYGGLSVLVRHFYDVKRLLTLPPGAFSPPPKVHSAVVVLTPHH 198

Query: 296 RLPP 307
R PP
Sbjct: 199 RTPP 202


>tr|A8N2K5|A8N2K5_COPC7 Putative uncharacterized protein
OS=Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC
9003) GN=CC1G_01722 PE=4 SV=1
Length = 1080

Score = 32.7 bits (73), Expect = 9.3
Identities = 14/30 (46%), Positives = 21/30 (70%)
Frame = +2

Query: 215 NLLTMPPSRHLQKQRQHCQHPALDVHIRLP 304
+LL +PP+RHL + Q ++P +D IRLP
Sbjct: 188 SLLALPPTRHLARVEQPDRYPEIDGVIRLP 217