BP911569
Clone id YMU001_000006_E04
Library
Length 550
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000006_E04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTCGACATCAAAACTGCTTTTCTTCATGGAGTTCTGTGCGAACTCATCTACATGTATCAG
CCAGCCCACTTCGCCAATCCAGCTTATCCAAATCATGTGTGCCAACTCAACAAGCCCATA
TATGGTCTCAAGCAATCTGCTCGACAATGGTATACGCGGATGCATGAGTACCTAATTGGC
TGTGGCTGGGAGTGTCTTCAAATTGACTATAACCCTTATATCTGGCGTTCTGCTGAAGGT
ATGGCCATACTTGGTCTCTTGGTTGATGATATTCCTCTATAAGGCACTTCCGAACATATC
ATTTTGAAAGCCATAGATTGCCTTTCCCAAGAGTTTCCCATCACTGACAAGGGTCCGATG
TCTTATTTCTTGGGCATCCAAGTGACGCGCGATCCAATCCACAAAACCATTAGTCTTTCT
CAATCACAATACATTGAGGAACTCCTTCTTTATTATGGTATGTCTGCATCATCCCTCTCC
CTCTTAAGCACAAGCTTGCACCAGAATATCATGCTTACACTCACGTTGATGCCTTATATT
TTCCTAACTT
■■Homology search results ■■ -
sp_hit_id P10978
Definition sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum
Align length 147
Score (bit) 98.6
E-value 2.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911569|Adiantum capillus-veneris mRNA, clone:
YMU001_000006_E04.
(550 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from tra... 99 2e-20
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster G... 70 7e-12
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W O... 64 5e-10
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Sa... 56 1e-07
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Sa... 56 1e-07
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=... 51 4e-06
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=... 51 4e-06
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=... 51 4e-06
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=... 51 4e-06
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=... 51 4e-06
sp|Q12503|YF21B_YEAST Transposon Ty2-F/Ty2-GR2 Gag-Pol polyprote... 51 4e-06
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=... 51 4e-06
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=... 51 4e-06
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=... 51 4e-06
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Sa... 51 4e-06
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Sa... 51 4e-06
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=... 47 8e-05
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=S... 47 8e-05
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=... 46 1e-04
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=... 46 1e-04
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=S... 46 1e-04
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=S... 46 1e-04
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=S... 46 1e-04
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=... 46 1e-04
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=... 46 1e-04
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=... 46 1e-04
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=... 46 1e-04
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=... 46 1e-04
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=... 46 1e-04
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=... 46 1e-04

>sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from
transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1
Length = 1328

Score = 98.6 bits (244), Expect = 2e-20
Identities = 59/147 (40%), Positives = 82/147 (55%), Gaps = 1/147 (0%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LD+KTAFLHG L E IYM QP F + VC+LNK +YGLKQ+ RQWY + ++
Sbjct: 921 LDVKTAFLHGDLEEEIYMEQPEGFEVAGKKHMVCKLNKSLYGLKQAPRQWYMKFDSFMKS 980

Query: 181 CGWECLQIDYNPYIWRSAE-GMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDKGP 357
+ D Y R +E IL L VDD+ + G + +I K LS+ F + D GP
Sbjct: 981 QTYLKTYSDPCVYFKRFSENNFIILLLYVDDMLIVGKDKGLIAKLKGDLSKSFDMKDLGP 1040

Query: 358 MSYFLGIQVTRDPIHKTISLSQSQYIE 438
LG+++ R+ + + LSQ +YIE
Sbjct: 1041 AQQILGMKIVRERTSRKLWLSQEKYIE 1067


>sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP
PE=1 SV=3
Length = 1409

Score = 70.1 bits (170), Expect = 7e-12
Identities = 51/150 (34%), Positives = 79/150 (52%), Gaps = 3/150 (2%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
+D+KTAFL+G L E IYM P + ++VC+LNK IYGLKQ+AR W+ + L
Sbjct: 1001 MDVKTAFLNGTLKEEIYMRLPQGIS--CNSDNVCKLNKAIYGLKQAARCWFEVFEQALKE 1058

Query: 181 CGWECLQIDYNPYIWRSA---EGMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDK 351
C + +D YI E + +L L VDD+ + + L ++F +TD
Sbjct: 1059 CEFVNSSVDRCIYILDKGNINENIYVL-LYVDDVVIATGDMTRMNNFKRYLMEKFRMTDL 1117

Query: 352 GPMSYFLGIQVTRDPIHKTISLSQSQYIEE 441
+ +F+GI++ I LSQS Y+++
Sbjct: 1118 NEIKHFIGIRIEMQ--EDKIYLSQSAYVKK 1145


>sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W
OS=Saccharomyces cerevisiae GN=TY5A PE=4 SV=2
Length = 308

Score = 63.9 bits (154), Expect = 5e-10
Identities = 41/145 (28%), Positives = 75/145 (51%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
+D+ TAFL+ + E IY+ QP F N P++V +L +YGLKQ+ W ++ L
Sbjct: 1 MDVDTAFLNSTMDEPIYVKQPPGFVNERNPDYVWELYGGMYGLKQAPLLWNEHINNTLKK 60

Query: 181 CGWECLQIDYNPYIWRSAEGMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDKGPM 360
G+ + ++ Y +++G + + VDD+ + S I + L++ + + D G +
Sbjct: 61 IGFCRHEGEHGLYFRSTSDGPIYIAVYVDDLLVAAPSPKIYDRVKQELTKLYSMKDLGKV 120

Query: 361 SYFLGIQVTRDPIHKTISLSQSQYI 435
FLG+ + + + I+LS YI
Sbjct: 121 DKFLGLNIHQSS-NGDITLSLQDYI 144


>sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY4B-J PE=2 SV=2
Length = 1803

Score = 55.8 bits (133), Expect = 1e-07
Identities = 42/151 (27%), Positives = 74/151 (49%), Gaps = 6/151 (3%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LDI AFL+ L E IY+ +P V +LNK +YGLKQS ++W + +YL G
Sbjct: 1383 LDINHAFLYAKLEEEIYI------PHPHDRRCVVKLNKALYGLKQSPKEWNDHLRQYLNG 1436

Query: 181 CGWECLQIDYNPYIWRSAEGMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDKGPM 360
G + Y P ++++ + ++ + VDD + ++E + + I+ L F + G +
Sbjct: 1437 IGLK--DNSYTPGLYQTEDKNLMIAVYVDDCVIAASNEQRLDEFINKLKSNFELKITGTL 1494

Query: 361 ------SYFLGIQVTRDPIHKTISLSQSQYI 435
+ LG+ + + TI L+ +I
Sbjct: 1495 IDDVLDTDILGMDLVYNKRLGTIDLTLKSFI 1525


>sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY4B-H PE=2 SV=1
Length = 1802

Score = 55.8 bits (133), Expect = 1e-07
Identities = 42/151 (27%), Positives = 74/151 (49%), Gaps = 6/151 (3%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LDI AFL+ L E IY+ +P V +LNK +YGLKQS ++W + +YL G
Sbjct: 1382 LDINHAFLYAKLEEEIYI------PHPHDRRCVVKLNKALYGLKQSPKEWNDHLRQYLNG 1435

Query: 181 CGWECLQIDYNPYIWRSAEGMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDKGPM 360
G + Y P ++++ + ++ + VDD + ++E + + I+ L F + G +
Sbjct: 1436 IGLK--DNSYTPGLYQTEDKNLMIAVYVDDCVIAASNEQRLDEFINKLKSNFELKITGTL 1493

Query: 361 ------SYFLGIQVTRDPIHKTISLSQSQYI 435
+ LG+ + + TI L+ +I
Sbjct: 1494 IDDVLDTDILGMDLVYNKRLGTIDLTLKSFI 1524


>sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY2B-OR2 PE=3 SV=1
Length = 1770

Score = 50.8 bits (120), Expect = 4e-06
Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 7/73 (9%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LDI +A+L+ + E +Y+ P H + + +L K +YGLKQS WY + YLI
Sbjct: 1360 LDISSAYLYADIKEELYIRPPPHLG---LNDKLLRLRKSLYGLKQSGANWYETIKSYLIN 1416

Query: 181 C-------GWECL 198
C GW C+
Sbjct: 1417 CCDMQEVRGWSCV 1429


>sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY2B-OR1 PE=3 SV=1
Length = 1770

Score = 50.8 bits (120), Expect = 4e-06
Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 7/73 (9%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LDI +A+L+ + E +Y+ P H + + +L K +YGLKQS WY + YLI
Sbjct: 1360 LDISSAYLYADIKEELYIRPPPHLG---LNDKLLRLRKSLYGLKQSGANWYETIKSYLIN 1416

Query: 181 C-------GWECL 198
C GW C+
Sbjct: 1417 CCDMQEVRGWSCV 1429


>sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY2B-LR2 PE=2 SV=1
Length = 1598

Score = 50.8 bits (120), Expect = 4e-06
Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 7/73 (9%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LDI +A+L+ + E +Y+ P H + + +L K +YGLKQS WY + YLI
Sbjct: 1360 LDISSAYLYADIKEELYIRPPPHLG---LNDKLLRLRKSLYGLKQSGANWYETIKSYLIN 1416

Query: 181 C-------GWECL 198
C GW C+
Sbjct: 1417 CCDMQEVRGWSCV 1429


>sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY2B-LR1 PE=3 SV=1
Length = 1770

Score = 50.8 bits (120), Expect = 4e-06
Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 7/73 (9%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LDI +A+L+ + E +Y+ P H + + +L K +YGLKQS WY + YLI
Sbjct: 1360 LDISSAYLYADIKEELYIRPPPHLG---LNDKLLRLRKSLYGLKQSGANWYETIKSYLIN 1416

Query: 181 C-------GWECL 198
C GW C+
Sbjct: 1417 CCDMQEVRGWSCV 1429


>sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY2B-GR1 PE=2 SV=2
Length = 1770

Score = 50.8 bits (120), Expect = 4e-06
Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 7/73 (9%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LDI +A+L+ + E +Y+ P H + + +L K +YGLKQS WY + YLI
Sbjct: 1360 LDISSAYLYADIKEELYIRPPPHLG---LNDKLLRLRKSLYGLKQSGANWYETIKSYLIN 1416

Query: 181 C-------GWECL 198
C GW C+
Sbjct: 1417 CCDMQEVRGWSCV 1429


tr_hit_id O81824
Definition tr|O81824|O81824_ARATH Putative uncharacterized protein AT4g27210 OS=Arabidopsis thaliana
Align length 147
Score (bit) 121.0
E-value 2.0e-26
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911569|Adiantum capillus-veneris mRNA, clone:
YMU001_000006_E04.
(550 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|O81824|O81824_ARATH Putative uncharacterized protein AT4g2721... 121 2e-26
tr|Q0JQQ4|Q0JQQ4_ORYSJ Os01g0146700 protein OS=Oryza sativa subs... 119 8e-26
tr|B4FZ33|B4FZ33_MAIZE Putative uncharacterized protein OS=Zea m... 118 2e-25
tr|Q9SLL4|Q9SLL4_ARATH Putative retroelement pol polyprotein OS=... 117 3e-25
tr|A5AS82|A5AS82_VITVI Putative uncharacterized protein OS=Vitis... 117 5e-25
tr|A5BQ39|A5BQ39_VITVI Putative uncharacterized protein OS=Vitis... 116 7e-25
tr|A5B6R5|A5B6R5_VITVI Putative uncharacterized protein OS=Vitis... 116 7e-25
tr|A5BZH7|A5BZH7_VITVI Putative uncharacterized protein OS=Vitis... 116 9e-25
tr|A5BIR7|A5BIR7_VITVI Putative uncharacterized protein OS=Vitis... 115 1e-24
tr|A5AIZ6|A5AIZ6_VITVI Putative uncharacterized protein OS=Vitis... 115 1e-24
tr|A5B1N8|A5B1N8_VITVI Putative uncharacterized protein OS=Vitis... 114 3e-24
tr|A5BPJ0|A5BPJ0_VITVI Putative uncharacterized protein OS=Vitis... 113 8e-24
tr|Q9MA73|Q9MA73_ARATH F2J6.8 protein OS=Arabidopsis thaliana GN... 112 1e-23
tr|Q0JET4|Q0JET4_ORYSJ Os04g0205800 protein OS=Oryza sativa subs... 112 1e-23
tr|A5B0S9|A5B0S9_VITVI Putative uncharacterized protein OS=Vitis... 112 1e-23
tr|A5C715|A5C715_VITVI Putative uncharacterized protein OS=Vitis... 112 1e-23
tr|A5AR65|A5AR65_VITVI Putative uncharacterized protein OS=Vitis... 112 1e-23
tr|Q9SSB1|Q9SSB1_ARATH T18A20.5 protein OS=Arabidopsis thaliana ... 112 2e-23
tr|Q0E469|Q0E469_ORYSJ Os02g0133500 protein OS=Oryza sativa subs... 112 2e-23
tr|Q2R3U8|Q2R3U8_ORYSJ Os11g0502200 protein OS=Oryza sativa subs... 111 2e-23
tr|A5AQ04|A5AQ04_VITVI Putative uncharacterized protein OS=Vitis... 111 2e-23
tr|O23450|O23450_ARATH Reverse transcriptase like protein OS=Ara... 110 4e-23
tr|A5BNR9|A5BNR9_VITVI Putative uncharacterized protein OS=Vitis... 110 4e-23
tr|A5AYB0|A5AYB0_VITVI Putative uncharacterized protein OS=Vitis... 110 4e-23
tr|A5CAE5|A5CAE5_VITVI Putative uncharacterized protein OS=Vitis... 110 5e-23
tr|A5AUK6|A5AUK6_VITVI Putative uncharacterized protein OS=Vitis... 110 5e-23
tr|Q9SXF0|Q9SXF0_ARATH T3P18.3 OS=Arabidopsis thaliana PE=4 SV=1 110 6e-23
tr|Q94IU9|Q94IU9_ARATH Copia-like polyprotein OS=Arabidopsis tha... 110 6e-23
tr|Q2QMT9|Q2QMT9_ORYSJ Os12g0591100 protein OS=Oryza sativa subs... 110 6e-23
tr|O82331|O82331_ARATH Putative retroelement pol polyprotein OS=... 110 6e-23

>tr|O81824|O81824_ARATH Putative uncharacterized protein AT4g27210
OS=Arabidopsis thaliana GN=AT4g27210 PE=4 SV=1
Length = 1318

Score = 121 bits (304), Expect = 2e-26
Identities = 61/147 (41%), Positives = 91/147 (61%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
+D+K AFLHG L E +YM QPA F +P+ P+HVC L+K IYGLKQS R W+ + +L+
Sbjct: 821 MDVKNAFLHGDLKETVYMTQPAGFVDPSKPDHVCLLHKSIYGLKQSPRAWFDKFSTFLLE 880

Query: 181 CGWECLQIDYNPYIWRSAEGMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDKGPM 360
G+ C + D + +I+ + +L L VDD+ + G S + + L++EF +TD G +
Sbjct: 881 FGFFCSKSDPSLFIYAHNNNLILLLLYVDDMVITGNSSQTLTSLLAALNKEFRMTDMGQL 940

Query: 361 SYFLGIQVTRDPIHKTISLSQSQYIEE 441
YFLGIQV R + +SQ +Y E+
Sbjct: 941 HYFLGIQVQRQ--QNGLFMSQQKYAED 965


>tr|Q0JQQ4|Q0JQQ4_ORYSJ Os01g0146700 protein OS=Oryza sativa subsp.
japonica GN=Os01g0146700 PE=4 SV=1
Length = 1181

Score = 119 bits (299), Expect = 8e-26
Identities = 64/147 (43%), Positives = 90/147 (61%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LD+K AFLHG L E +Y QP FA+P++ + VC+LNK +YGLKQ+ R W+ R +LI
Sbjct: 781 LDVKNAFLHGTLSETVYCIQPTGFADPSHADLVCRLNKSLYGLKQAPRAWHHRFASHLIS 840

Query: 181 CGWECLQIDYNPYIWRSAEGMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDKGPM 360
G+ Q D + +I R +L L VDDI L +S ++ + I L +EF +TD GP+
Sbjct: 841 LGFIEAQSDSSLFIHRRGNDTVLLLLYVDDIVLTASSASLLQQVIAALQREFAMTDMGPL 900

Query: 361 SYFLGIQVTRDPIHKTISLSQSQYIEE 441
+FLGI VTR + LSQ QY ++
Sbjct: 901 HHFLGITVTR--FASGLFLSQRQYSQD 925


>tr|B4FZ33|B4FZ33_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 497

Score = 118 bits (296), Expect = 2e-25
Identities = 61/144 (42%), Positives = 88/144 (61%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LD+K AFLHG L E +Y QP+ F +P+ P+HVC+L+K +YGLKQ+ R W+ R +L
Sbjct: 122 LDVKNAFLHGTLSETVYSQQPSDFVDPSLPHHVCKLHKSLYGLKQAPRTWFLRFTTFLSS 181

Query: 181 CGWECLQIDYNPYIWRSAEGMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDKGPM 360
G+ + D + +I ++ A L L VDDI L + H++ I L EF ++D GP+
Sbjct: 182 IGFTQSKCDPSLFILKTPSTTAYLLLYVDDIILTANTSHLLSHIISQLCSEFSMSDLGPL 241

Query: 361 SYFLGIQVTRDPIHKTISLSQSQY 432
+FLGI+VT P + LSQ QY
Sbjct: 242 RHFLGIEVT--PSDTGLVLSQKQY 263


>tr|Q9SLL4|Q9SLL4_ARATH Putative retroelement pol polyprotein
OS=Arabidopsis thaliana GN=At2g06950 PE=4 SV=1
Length = 1402

Score = 117 bits (294), Expect = 3e-25
Identities = 60/147 (40%), Positives = 90/147 (61%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
+D+K AFLHG L E +YM QPA F + + P HVC L+K IYGLKQS R W+ + +L+
Sbjct: 1032 MDVKNAFLHGDLNETVYMTQPAGFVDKSKPTHVCLLHKSIYGLKQSPRAWFDKFSTFLLE 1091

Query: 181 CGWECLQIDYNPYIWRSAEGMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDKGPM 360
G+ C + D + +I+ + +L L VDD+ + G S + + L++EF +TD G +
Sbjct: 1092 FGFFCSKSDPSLFIYAHNNNLILLLLYVDDMVITGNSSQTLSSLLAALNKEFRMTDMGQL 1151

Query: 361 SYFLGIQVTRDPIHKTISLSQSQYIEE 441
YFLGIQV R+ + +SQ +Y E+
Sbjct: 1152 HYFLGIQVQRN--QHGLFMSQQKYAED 1176


>tr|A5AS82|A5AS82_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_011746 PE=4 SV=1
Length = 879

Score = 117 bits (292), Expect = 5e-25
Identities = 59/145 (40%), Positives = 87/145 (60%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LD+ AFLHG+L E +YM QP F N +P++VC+LNK +YGLKQ+ R W+ R+ + L+
Sbjct: 513 LDVSNAFLHGILLEDVYMEQPKGFVNSEFPDYVCKLNKSLYGLKQAPRAWFMRLSQTLLE 572

Query: 181 CGWECLQIDYNPYIWRSAEGMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDKGPM 360
G+ +D + +++ + + VDDI + GT +I I L EF + D GP+
Sbjct: 573 FGFLSSPVDASLFVYHKGHIHLFILIYVDDILVTGTXPSLIXSLIQKLQTEFKMKDLGPL 632

Query: 361 SYFLGIQVTRDPIHKTISLSQSQYI 435
YFLGIQ +RD + L QS+YI
Sbjct: 633 GYFLGIQASRD--SSGLHLXQSKYI 655


>tr|A5BQ39|A5BQ39_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024133 PE=4 SV=1
Length = 555

Score = 116 bits (291), Expect = 7e-25
Identities = 58/147 (39%), Positives = 95/147 (64%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LD+ AFL G L E ++M QP F + +P++VC+L+K IYGLKQ+ R WY ++ ++L+
Sbjct: 366 LDVNNAFLQGRLSENVFMAQPPSFVDSDHPSYVCKLHKAIYGLKQAPRAWYHKLRQFLLT 425

Query: 181 CGWECLQIDYNPYIWRSAEGMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDKGPM 360
G++ D + +++RS+ + L + VDDI L G S+ ++ + +D L+Q F + D G +
Sbjct: 426 SGFKNSHSDTSLFVFRSSNHVLYLLIYVDDIILTGNSDTLVSQLVDYLAQRFSLKDLGQL 485

Query: 361 SYFLGIQVTRDPIHKTISLSQSQYIEE 441
SYFLG++V P I LSQ +YI++
Sbjct: 486 SYFLGVEVV--PHRLGILLSQRRYIQD 510


>tr|A5B6R5|A5B6R5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_036280 PE=4 SV=1
Length = 1379

Score = 116 bits (291), Expect = 7e-25
Identities = 59/144 (40%), Positives = 89/144 (61%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LD+K AFL+G+L E +YM QP + +P +P HVC+L K +YGLKQ+ R W+ R +L+
Sbjct: 385 LDVKNAFLNGILHETVYMEQPLGYVDPRHPLHVCKLKKALYGLKQAPRAWFQRFSSFLLK 444

Query: 181 CGWECLQIDYNPYIWRSAEGMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDKGPM 360
G+ C + D + +++ + + L L VDDI L G + +I + I L EF + D GP+
Sbjct: 445 LGFFCSRADTSLFVFTKKDDLIYLLLYVDDIILTGNNPALINRFISQLHSEFAVKDLGPL 504

Query: 361 SYFLGIQVTRDPIHKTISLSQSQY 432
SYFLG++V+ P LSQ +Y
Sbjct: 505 SYFLGLEVSYIP--DGFFLSQVKY 526


>tr|A5BZH7|A5BZH7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_007280 PE=4 SV=1
Length = 619

Score = 116 bits (290), Expect = 9e-25
Identities = 55/147 (37%), Positives = 90/147 (61%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LD+ AFL G + E +YM QP F + P HVC+L+K IYGLKQ+ R WY + ++L+
Sbjct: 247 LDVNNAFLQGTISETVYMAQPPGFIDADKPTHVCKLHKAIYGLKQAPRTWYHELCQFLVD 306

Query: 181 CGWECLQIDYNPYIWRSAEGMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDKGPM 360
G++ D + ++ + + L + VDDI + G S+ ++ + ++CL+Q F + D GP+
Sbjct: 307 FGFKNSHSDTSLFVLHAGTNLLYLLVYVDDIIITGNSDDLVSQVVECLAQRFSLKDLGPL 366

Query: 361 SYFLGIQVTRDPIHKTISLSQSQYIEE 441
SYFLG++V + LSQ +YI++
Sbjct: 367 SYFLGVEVVHH--RHGLLLSQRRYIKD 391


>tr|A5BIR7|A5BIR7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_004139 PE=4 SV=1
Length = 1556

Score = 115 bits (289), Expect = 1e-24
Identities = 65/146 (44%), Positives = 89/146 (60%), Gaps = 2/146 (1%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LD+K AFLHG++ E I+M QP A+ +P HVC+L K +YGLKQ+ R W+ R +L+
Sbjct: 1112 LDVKNAFLHGLISEDIHMEQPPGMADLEHPTHVCKLQKALYGLKQAPRAWFDRFSAFLLK 1171

Query: 181 CGWECLQIDYNPYIWRSAEGMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDKGPM 360
G+ C D + +I+ S G IL L VDDI L G+S ++ I LS EF + D G +
Sbjct: 1172 YGFFCSLADPSLFIFHSNLGSLILLLYVDDILLTGSSTALVSTFIQLLSSEFAMKDLGQI 1231

Query: 361 SYFLGIQV--TRDPIHKTISLSQSQY 432
YFLGI++ T D +H LSQS Y
Sbjct: 1232 HYFLGIEISQTADGLH----LSQSHY 1253



Score = 42.0 bits (97), Expect = 0.022
Identities = 31/130 (23%), Positives = 57/130 (43%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
+D++ AFLHG E +YM P F + +++ ++YT + +
Sbjct: 109 MDVQNAFLHGDFLEEVYMQLPPSF----------------HRQEETPMKFYTTIQQD--- 149

Query: 181 CGWECLQIDYNPYIWRSAEGMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDKGPM 360
G+ ++DY+ + + + VDDI + E++I L +F I D +
Sbjct: 150 -GFHQSRVDYSLFTKIFGNSFTDVLIYVDDIIITDNYENVIAALKKSLHTKFRIKDLVQL 208

Query: 361 SYFLGIQVTR 390
YFL I++ R
Sbjct: 209 RYFLSIEIAR 218


>tr|A5AIZ6|A5AIZ6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_015226 PE=4 SV=1
Length = 1007

Score = 115 bits (289), Expect = 1e-24
Identities = 59/147 (40%), Positives = 91/147 (61%)
Frame = +1

Query: 1 LDIKTAFLHGVLCELIYMYQPAHFANPAYPNHVCQLNKPIYGLKQSARQWYTRMHEYLIG 180
LD++ AFLHG L E ++M+QP F N +P+HVC+LNK +YGLKQ+ R WYT++ L+G
Sbjct: 577 LDVQNAFLHGTLEEHVFMHQPPGFINSQFPSHVCKLNKALYGLKQAPRAWYTKLSTSLLG 636

Query: 181 CGWECLQIDYNPYIWRSAEGMAILGLLVDDIPL*GTSEHIILKAIDCLSQEFPITDKGPM 360
G++ + D + +I S + IL + VDDI + G++ + I L+ F + D G +
Sbjct: 637 WGFQASRADSSMFIHHSTHDVLILLIYVDDILVTGSNSAQVSSFITRLNSSFALRDLGYV 696

Query: 361 SYFLGIQVTRDPIHKTISLSQSQYIEE 441
+YFLGI+V R LSQ +Y ++
Sbjct: 697 NYFLGIKVVRS--GXMFHLSQHKYTQD 721