BP911575
Clone id YMU001_000006_E12
Library
Length 571
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000006_E12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGCTGGTTACAAGTTCCGAGGTCCCGTTTGGAGTTTAGCAAATGCTATTGATCGTCAGCA
GACCACTCTGCTGTTAAAGTCATCTGATGATTGGCTCCGACGACTCCATGTGCGACATCC
TGACTTTGACTATTTCATGGCGCATTTCACATCAAATGGTCACTGAGCTCAACAAACAGC
AATTGGGTTCTTGTGGCTCGCTTTTATTGCACATGTATCTATTTTTGCGCACTGTTTGAA
TATGGCCACTACTAGGATTTTATTTTCGGTTAAGGAAATTCGTGGTACTAGAATGTATCT
AGGGGGGGAGGCATGTAAATGAGGGTTGTTCCGATGCGACAGAAGGAAGGCAGATGATGA
CAGATTGAGACTTTCTCGATAGTGTCTGGTCCAGAGATGATAGAACTTATCATTTATGTA
TGAGGCTTTTCATCGCACATACATATTAAATTTTGAGGAAATTGGGCACTAGTAAAACTG
TATGTCTTGCCTTGTGGCAAGAACTTGGTGCGTTTTGATCAAGGGAGATCTAGCTGTTTA
TAAACCTCAGAATGTTATAAATTTGCACATG
■■Homology search results ■■ -
sp_hit_id Q8R666
Definition sp|Q8R666|COBS_FUSNN Cobalamin synthase OS=Fusobacterium nucleatum subsp. nucleatum
Align length 50
Score (bit) 31.2
E-value 3.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911575|Adiantum capillus-veneris mRNA, clone:
YMU001_000006_E12.
(571 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8R666|COBS_FUSNN Cobalamin synthase OS=Fusobacterium nucleat... 31 3.8
sp|Q83GC6|SYL_TROWT Leucyl-tRNA synthetase OS=Tropheryma whipple... 30 8.5
sp|Q83HV5|SYL_TROW8 Leucyl-tRNA synthetase OS=Tropheryma whipple... 30 8.5

>sp|Q8R666|COBS_FUSNN Cobalamin synthase OS=Fusobacterium nucleatum
subsp. nucleatum GN=cobS PE=3 SV=1
Length = 278

Score = 31.2 bits (69), Expect = 3.8
Identities = 15/50 (30%), Positives = 27/50 (54%)
Frame = +3

Query: 102 DSMCDILTLTISWRISHQMVTELNKQQLGSCGSLLLHMYLFLRTV*IWPL 251
D + D S+R H+M+ + +LGS G+L L +Y L+ + ++ L
Sbjct: 85 DGLADTFDGIFSYRSKHKMLEIMKDSRLGSNGALALILYFLLKFILLFSL 134


>sp|Q83GC6|SYL_TROWT Leucyl-tRNA synthetase OS=Tropheryma whipplei
(strain Twist) GN=leuS PE=3 SV=1
Length = 806

Score = 30.0 bits (66), Expect = 8.5
Identities = 12/34 (35%), Positives = 19/34 (55%)
Frame = +2

Query: 26 VWSLANAIDRQQTTLLLKSSDDWLRRLHVRHPDF 127
VW+ N + ++ L +S DW RRLH P++
Sbjct: 111 VWTYRNIDQQARSMRLYAASFDWSRRLHTSDPEY 144


>sp|Q83HV5|SYL_TROW8 Leucyl-tRNA synthetase OS=Tropheryma whipplei
(strain TW08/27) GN=leuS PE=3 SV=1
Length = 806

Score = 30.0 bits (66), Expect = 8.5
Identities = 12/34 (35%), Positives = 19/34 (55%)
Frame = +2

Query: 26 VWSLANAIDRQQTTLLLKSSDDWLRRLHVRHPDF 127
VW+ N + ++ L +S DW RRLH P++
Sbjct: 111 VWTYRNIDQQARSMRLYAASFDWSRRLHTSDPEY 144


tr_hit_id Q6YSZ2
Definition tr|Q6YSZ2|Q6YSZ2_ORYSJ Os07g0246600 protein OS=Oryza sativa subsp. japonica
Align length 51
Score (bit) 51.6
E-value 3.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911575|Adiantum capillus-veneris mRNA, clone:
YMU001_000006_E12.
(571 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q6YSZ2|Q6YSZ2_ORYSJ Os07g0246600 protein OS=Oryza sativa subs... 52 3e-05
tr|B8B4R5|B8B4R5_ORYSI Putative uncharacterized protein OS=Oryza... 52 3e-05
tr|Q656E5|Q656E5_ORYSJ Putative uncharacterized protein OSJNBb00... 50 7e-05
tr|B8A6S1|B8A6S1_ORYSI Putative uncharacterized protein OS=Oryza... 50 7e-05
tr|A2ZSA9|A2ZSA9_ORYSJ Putative uncharacterized protein OS=Oryza... 50 7e-05
tr|Q7XKI4|Q7XKI4_ORYSJ Os04g0528000 protein OS=Oryza sativa subs... 50 9e-05
tr|Q01HN7|Q01HN7_ORYSA OSIGBa0115K01-H0319F09.15 protein OS=Oryz... 50 9e-05
tr|A2XVR1|A2XVR1_ORYSI Putative uncharacterized protein OS=Oryza... 50 9e-05
tr|B4FYZ9|B4FYZ9_MAIZE Putative uncharacterized protein OS=Zea m... 50 1e-04
tr|A7PGX7|A7PGX7_VITVI Chromosome chr17 scaffold_16, whole genom... 49 2e-04
tr|B4FNB9|B4FNB9_MAIZE Putative uncharacterized protein OS=Zea m... 49 3e-04
tr|A7P3D4|A7P3D4_VITVI Chromosome chr1 scaffold_5, whole genome ... 48 3e-04
tr|A5BKM4|A5BKM4_VITVI Putative uncharacterized protein OS=Vitis... 48 3e-04
tr|A7Q8K6|A7Q8K6_VITVI Chromosome chr5 scaffold_64, whole genome... 47 6e-04
tr|Q9ZU41|Q9ZU41_ARATH Predicted by genscan and genefinder (Puta... 47 8e-04
tr|Q9FJ18|Q9FJ18_ARATH Gb|AAF31026.1 OS=Arabidopsis thaliana PE=... 46 0.002
tr|Q8VZK6|Q8VZK6_ARATH Putative uncharacterized protein At5g4922... 46 0.002
tr|A9RSK0|A9RSK0_PHYPA Predicted protein OS=Physcomitrella paten... 45 0.002
tr|B6TZP5|B6TZP5_MAIZE Putative uncharacterized protein OS=Zea m... 45 0.003
tr|B4FY71|B4FY71_MAIZE Putative uncharacterized protein OS=Zea m... 45 0.003
tr|Q940I8|Q940I8_ARATH Putative uncharacterized protein Z97340.1... 45 0.004
tr|Q8LNT2|Q8LNT2_ORYSJ Os10g0494000 protein OS=Oryza sativa subs... 45 0.004
tr|A9P9W8|A9P9W8_POPTR Putative uncharacterized protein OS=Popul... 45 0.004
tr|A2Z8W3|A2Z8W3_ORYSI Putative uncharacterized protein OS=Oryza... 45 0.004
tr|Q9M9Q2|Q9M9Q2_ARATH T15D22.8 (Putative uncharacterized protei... 44 0.005
tr|Q9LR63|Q9LR63_ARATH F21B7.22 OS=Arabidopsis thaliana PE=4 SV=1 43 0.011
tr|Q8RY13|Q8RY13_ARATH At1g03610/F21B7_13 OS=Arabidopsis thalian... 43 0.011
tr|Q8LF98|Q8LF98_ARATH Putative uncharacterized protein OS=Arabi... 43 0.011
tr|Q5QND0|Q5QND0_ORYSJ cDNA clone:J023025D18, full insert sequen... 43 0.011
tr|A9RZ13|A9RZ13_PHYPA Predicted protein OS=Physcomitrella paten... 43 0.011

>tr|Q6YSZ2|Q6YSZ2_ORYSJ Os07g0246600 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0003K21.26 PE=4 SV=1
Length = 455

Score = 51.6 bits (122), Expect = 3e-05
Identities = 21/51 (41%), Positives = 31/51 (60%)
Frame = +2

Query: 2 AGYKFRGPVWSLANAIDRQQTTLLLKSSDDWLRRLHVRHPDFDYFMAHFTS 154
A YK R VWS ++Q L++++DDWLR V HPDF +F+ H+ +
Sbjct: 402 APYKLRSSVWSSNGPHEQQLAASLMQAADDWLRDRQVHHPDFRFFLTHYNT 452


>tr|B8B4R5|B8B4R5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_25510 PE=4 SV=1
Length = 462

Score = 51.6 bits (122), Expect = 3e-05
Identities = 21/51 (41%), Positives = 31/51 (60%)
Frame = +2

Query: 2 AGYKFRGPVWSLANAIDRQQTTLLLKSSDDWLRRLHVRHPDFDYFMAHFTS 154
A YK R VWS ++Q L++++DDWLR V HPDF +F+ H+ +
Sbjct: 409 APYKLRSSVWSSNGPHEQQLAASLMQAADDWLRDRQVHHPDFRFFLTHYNT 459


>tr|Q656E5|Q656E5_ORYSJ Putative uncharacterized protein
OSJNBb0022N24.15 (Os01g0306900 protein) OS=Oryza sativa
subsp. japonica GN=OSJNBb0022N24.15 PE=4 SV=1
Length = 357

Score = 50.4 bits (119), Expect = 7e-05
Identities = 20/48 (41%), Positives = 32/48 (66%)
Frame = +2

Query: 2 AGYKFRGPVWSLANAIDRQQTTLLLKSSDDWLRRLHVRHPDFDYFMAH 145
A +KF G +W+ ++Q T LLK++DDWL + V HPD+ +F++H
Sbjct: 310 ASHKFNGSMWTSNQEHEQQLTKSLLKAADDWLCQRRVNHPDYRFFLSH 357


>tr|B8A6S1|B8A6S1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_01578 PE=4 SV=1
Length = 372

Score = 50.4 bits (119), Expect = 7e-05
Identities = 20/48 (41%), Positives = 32/48 (66%)
Frame = +2

Query: 2 AGYKFRGPVWSLANAIDRQQTTLLLKSSDDWLRRLHVRHPDFDYFMAH 145
A +KF G +W+ ++Q T LLK++DDWL + V HPD+ +F++H
Sbjct: 325 ASHKFNGSMWTSNQEHEQQLTKSLLKAADDWLCQRRVNHPDYRFFLSH 372


>tr|A2ZSA9|A2ZSA9_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_001431 PE=4 SV=1
Length = 382

Score = 50.4 bits (119), Expect = 7e-05
Identities = 20/48 (41%), Positives = 32/48 (66%)
Frame = +2

Query: 2 AGYKFRGPVWSLANAIDRQQTTLLLKSSDDWLRRLHVRHPDFDYFMAH 145
A +KF G +W+ ++Q T LLK++DDWL + V HPD+ +F++H
Sbjct: 335 ASHKFNGSMWTSNQEHEQQLTKSLLKAADDWLCQRRVNHPDYRFFLSH 382


>tr|Q7XKI4|Q7XKI4_ORYSJ Os04g0528000 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0038O10.24 PE=4 SV=2
Length = 313

Score = 50.1 bits (118), Expect = 9e-05
Identities = 21/46 (45%), Positives = 34/46 (73%)
Frame = +2

Query: 2 AGYKFRGPVWSLANAIDRQQTTLLLKSSDDWLRRLHVRHPDFDYFM 139
A +K G VW+ AN+ D++ TT L+ ++D WL++L V+H DF+YF+
Sbjct: 248 ATHKTDGDVWTSANSGDQELTTSLVGAADSWLKKLDVQHHDFNYFL 293


>tr|Q01HN7|Q01HN7_ORYSA OSIGBa0115K01-H0319F09.15 protein OS=Oryza
sativa GN=OSIGBa0115K01-H0319F09.15 PE=4 SV=1
Length = 313

Score = 50.1 bits (118), Expect = 9e-05
Identities = 21/46 (45%), Positives = 34/46 (73%)
Frame = +2

Query: 2 AGYKFRGPVWSLANAIDRQQTTLLLKSSDDWLRRLHVRHPDFDYFM 139
A +K G VW+ AN+ D++ TT L+ ++D WL++L V+H DF+YF+
Sbjct: 248 ATHKTDGDVWTSANSGDQELTTSLVGAADSWLKKLDVQHHDFNYFL 293


>tr|A2XVR1|A2XVR1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_16724 PE=4 SV=1
Length = 313

Score = 50.1 bits (118), Expect = 9e-05
Identities = 21/46 (45%), Positives = 34/46 (73%)
Frame = +2

Query: 2 AGYKFRGPVWSLANAIDRQQTTLLLKSSDDWLRRLHVRHPDFDYFM 139
A +K G VW+ AN+ D++ TT L+ ++D WL++L V+H DF+YF+
Sbjct: 248 ATHKTDGDVWTSANSGDQELTTSLVGAADSWLKKLDVQHHDFNYFL 293


>tr|B4FYZ9|B4FYZ9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 360

Score = 49.7 bits (117), Expect = 1e-04
Identities = 19/51 (37%), Positives = 29/51 (56%)
Frame = +2

Query: 2 AGYKFRGPVWSLANAIDRQQTTLLLKSSDDWLRRLHVRHPDFDYFMAHFTS 154
A YK +WS + Q L++++DDWLR V HPDF +F+ H+ +
Sbjct: 307 ASYKLNSSIWSSNRPEEHQLVASLMQTADDWLRHRQVYHPDFRFFLTHYNT 357


>tr|A7PGX7|A7PGX7_VITVI Chromosome chr17 scaffold_16, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017727001
PE=4 SV=1
Length = 370

Score = 49.3 bits (116), Expect = 2e-04
Identities = 19/48 (39%), Positives = 31/48 (64%)
Frame = +2

Query: 2 AGYKFRGPVWSLANAIDRQQTTLLLKSSDDWLRRLHVRHPDFDYFMAH 145
A YKF+G +W + Q+ L++++D+ LR L V HPDF +F++H
Sbjct: 318 ASYKFKGSIWRQNGTCEHQRVNSLVQAADNRLRLLEVNHPDFQFFVSH 365