BP911580
Clone id YMU001_000006_F05
Library
Length 249
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000006_F05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCTTCACGGCATTCTCGTTGATAAACGGCTCATCGTACTTGTCGATGAGAGGTGTAAACT
TGGGAGACACTCTCAGGTTGGCAAGATCAGGATCAGATCTGACAGTCTTATAATCTTCAA
ATCCAGCTTCCATTGCTGCTTCTAATGCTGACAACCCTGCCTCCACCTCATTAAGTTTGG
AGTAACAACAAGCGATGTTGTAATTTGCGACAGCTTCTTCTTTGTACTCGGGCTTTGCGC
CGAGTACCT
■■Homology search results ■■ -
sp_hit_id Q6AR59
Definition sp|Q6AR59|ASSY_DESPS Argininosuccinate synthase OS=Desulfotalea psychrophila
Align length 57
Score (bit) 30.4
E-value 2.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911580|Adiantum capillus-veneris mRNA, clone:
YMU001_000006_F05.
(249 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6AR59|ASSY_DESPS Argininosuccinate synthase OS=Desulfotalea ... 30 2.9
sp|Q6GLV4|UBX1B_XENLA UBX domain-containing protein 1-B OS=Xenop... 29 6.4
sp|Q8CP83|ODO1_STAES 2-oxoglutarate dehydrogenase E1 component O... 29 6.4
sp|Q5HPC6|ODO1_STAEQ 2-oxoglutarate dehydrogenase E1 component O... 29 6.4
sp|Q6AR60|ARLY_DESPS Argininosuccinate lyase OS=Desulfotalea psy... 29 6.4

>sp|Q6AR59|ASSY_DESPS Argininosuccinate synthase OS=Desulfotalea
psychrophila GN=argG PE=3 SV=1
Length = 398

Score = 30.4 bits (67), Expect = 2.9
Identities = 17/57 (29%), Positives = 25/57 (43%)
Frame = -3

Query: 220 EEAVANYNIACCYSKLNEVEAGLSALEAAMEAGFEDYKTVRSDPDLANLRVSPKFTP 50
EE +NI +K N + + L + E G + DPD+ L VSP+ P
Sbjct: 157 EEYAKQHNIPVPTTKKNPYSSDENLLHISFEGGILESPWNEPDPDMFKLTVSPEMAP 213


>sp|Q6GLV4|UBX1B_XENLA UBX domain-containing protein 1-B OS=Xenopus
laevis GN=ubxn1-B PE=2 SV=1
Length = 290

Score = 29.3 bits (64), Expect = 6.4
Identities = 16/52 (30%), Positives = 26/52 (50%)
Frame = -3

Query: 160 AGLSALEAAMEAGFEDYKTVRSDPDLANLRVSPKFTPLIDKYDEPFINENAV 5
A SALE+ +E GF + ++ N + P L++ D+P I E +V
Sbjct: 2 ADCSALESLIEMGFSPSRAEKALSATGNQGIEPAMDWLVEHEDDPDIKEPSV 53


>sp|Q8CP83|ODO1_STAES 2-oxoglutarate dehydrogenase E1 component
OS=Staphylococcus epidermidis (strain ATCC 12228)
GN=odhA PE=3 SV=1
Length = 934

Score = 29.3 bits (64), Expect = 6.4
Identities = 15/50 (30%), Positives = 24/50 (48%)
Frame = -3

Query: 241 GAKPEYKEEAVANYNIACCYSKLNEVEAGLSALEAAMEAGFEDYKTVRSD 92
G Y + Y++ + ++VEA + A+E AME E +K V D
Sbjct: 403 GRSTTYSSDVAKGYDVPILHVNADDVEATIEAIEIAMEFRKEFHKDVVID 452


>sp|Q5HPC6|ODO1_STAEQ 2-oxoglutarate dehydrogenase E1 component
OS=Staphylococcus epidermidis (strain ATCC 35984 /
RP62A) GN=odhA PE=3 SV=1
Length = 934

Score = 29.3 bits (64), Expect = 6.4
Identities = 15/50 (30%), Positives = 24/50 (48%)
Frame = -3

Query: 241 GAKPEYKEEAVANYNIACCYSKLNEVEAGLSALEAAMEAGFEDYKTVRSD 92
G Y + Y++ + ++VEA + A+E AME E +K V D
Sbjct: 403 GRSTTYSSDVAKGYDVPILHVNADDVEATIEAIEIAMEFRKEFHKDVVID 452


>sp|Q6AR60|ARLY_DESPS Argininosuccinate lyase OS=Desulfotalea
psychrophila GN=argH PE=3 SV=1
Length = 464

Score = 29.3 bits (64), Expect = 6.4
Identities = 13/29 (44%), Positives = 21/29 (72%)
Frame = -3

Query: 178 KLNEVEAGLSALEAAMEAGFEDYKTVRSD 92
+L ++ AGLS++EA +EAG ++KT D
Sbjct: 60 ELEQIIAGLSSIEADIEAGVFEFKTEYED 88


tr_hit_id A9RPD5
Definition tr|A9RPD5|A9RPD5_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 81
Score (bit) 136.0
E-value 5.0e-31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911580|Adiantum capillus-veneris mRNA, clone:
YMU001_000006_F05.
(249 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RPD5|A9RPD5_PHYPA Predicted protein OS=Physcomitrella paten... 136 5e-31
tr|A9NVF4|A9NVF4_PICSI Putative uncharacterized protein OS=Picea... 134 2e-30
tr|A7P0A9|A7P0A9_VITVI Chromosome chr6 scaffold_3, whole genome ... 120 3e-26
tr|A5AKU0|A5AKU0_VITVI Putative uncharacterized protein OS=Vitis... 120 3e-26
tr|B7FKN6|B7FKN6_MEDTR Putative uncharacterized protein OS=Medic... 119 1e-25
tr|Q9AT39|Q9AT39_SOYBN SHOOT1 protein OS=Glycine max GN=SHOOT1 P... 116 6e-25
tr|Q9LKK3|Q9LKK3_ORYSA Putative tyrosine phosphatase (Fragment) ... 114 2e-24
tr|Q710P9|Q710P9_ORYSA Putative tyrosine phosphatase (Fragment) ... 114 2e-24
tr|Q69LC1|Q69LC1_ORYSJ Os07g0171100 protein OS=Oryza sativa subs... 114 2e-24
tr|Q69LC0|Q69LC0_ORYSJ cDNA clone:001-045-E07, full insert seque... 114 2e-24
tr|A2YIK9|A2YIK9_ORYSI Putative uncharacterized protein OS=Oryza... 114 2e-24
tr|Q94BS2|Q94BS2_ARATH Putative uncharacterized protein At1g5548... 111 2e-23
tr|Q8L972|Q8L972_ARATH Putative uncharacterized protein OS=Arabi... 111 2e-23
tr|A8HQJ5|A8HQJ5_CHLRE Predicted protein OS=Chlamydomonas reinha... 86 7e-16
tr|A4RTK0|A4RTK0_OSTLU Predicted protein OS=Ostreococcus lucimar... 84 4e-15
tr|Q01DP2|Q01DP2_OSTTA Putative SHOOT1 protein (ISS) OS=Ostreoco... 83 8e-15
tr|A8IIN7|A8IIN7_CHLRE Predicted protein OS=Chlamydomonas reinha... 72 1e-11
tr|Q9ZVU6|Q9ZVU6_ARATH T5A14.12 protein OS=Arabidopsis thaliana ... 72 1e-11
tr|A4RXF5|A4RXF5_OSTLU Predicted protein OS=Ostreococcus lucimar... 63 7e-09
tr|B7G6W9|B7G6W9_PHATR Predicted protein OS=Phaeodactylum tricor... 55 1e-06
tr|A8ZVN6|A8ZVN6_DESOH Tetratricopeptide TPR_2 repeat protein OS... 54 4e-06
tr|B5YNW3|B5YNW3_THAPS Predicted protein OS=Thalassiosira pseudo... 53 9e-06
tr|A8ZVN5|A8ZVN5_DESOH Tetratricopeptide TPR_2 repeat protein OS... 51 3e-05
tr|B1ZW57|B1ZW57_OPITP Tetratricopeptide TPR_2 repeat protein OS... 49 1e-04
tr|A7CS09|A7CS09_9BACT Tetratricopeptide TPR_2 repeat protein OS... 49 1e-04
tr|Q1D1C2|Q1D1C2_MYXXD Putative uncharacterized protein OS=Myxoc... 49 1e-04
tr|B2EEB1|B2EEB1_9BACT Tetratricopeptide TPR_2 repeat protein OS... 49 1e-04
tr|A8ZVN4|A8ZVN4_DESOH Tetratricopeptide TPR_2 repeat protein OS... 49 2e-04
tr|Q1Q062|Q1Q062_9BACT Putative uncharacterized protein OS=Candi... 48 2e-04
tr|B4U9U7|B4U9U7_HYDS0 Tetratricopeptide TPR_2 repeat protein OS... 48 3e-04

>tr|A9RPD5|A9RPD5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_117443 PE=4 SV=1
Length = 290

Score = 136 bits (343), Expect = 5e-31
Identities = 64/81 (79%), Positives = 73/81 (90%)
Frame = -3

Query: 247 VLGAKPEYKEEAVANYNIACCYSKLNEVEAGLSALEAAMEAGFEDYKTVRSDPDLANLRV 68
VLG KPE +EEAVA+YN+ACCYSKLN++E+GL ALE AMEAGF+DYKTVR DPDLA LR
Sbjct: 196 VLGLKPEAREEAVASYNVACCYSKLNQIESGLQALEEAMEAGFDDYKTVREDPDLALLRQ 255

Query: 67 SPKFTPLIDKYDEPFINENAV 5
SP FTPLI+KYDEPFINENA+
Sbjct: 256 SPGFTPLINKYDEPFINENAM 276


>tr|A9NVF4|A9NVF4_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 343

Score = 134 bits (338), Expect = 2e-30
Identities = 60/81 (74%), Positives = 74/81 (91%)
Frame = -3

Query: 247 VLGAKPEYKEEAVANYNIACCYSKLNEVEAGLSALEAAMEAGFEDYKTVRSDPDLANLRV 68
VLG+KPE +E AV +YN+ACCYS+LN++EAGLSALE AMEAG+EDY+T+R+DPD+ANLR
Sbjct: 251 VLGSKPERREAAVTSYNVACCYSQLNQIEAGLSALEDAMEAGYEDYQTIRTDPDIANLRS 310

Query: 67 SPKFTPLIDKYDEPFINENAV 5
S KF PL+DKYDEPFINENA+
Sbjct: 311 SEKFKPLLDKYDEPFINENAI 331


>tr|A7P0A9|A7P0A9_VITVI Chromosome chr6 scaffold_3, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00024835001
PE=4 SV=1
Length = 329

Score = 120 bits (301), Expect = 3e-26
Identities = 52/81 (64%), Positives = 71/81 (87%)
Frame = -3

Query: 247 VLGAKPEYKEEAVANYNIACCYSKLNEVEAGLSALEAAMEAGFEDYKTVRSDPDLANLRV 68
VLG+KP+ E + A+YN+ACCYSKLN+++AGLSALE A+EAG+ED+KT+R+DPDLAN+R
Sbjct: 236 VLGSKPDPNEASAASYNVACCYSKLNQIQAGLSALEDALEAGYEDFKTIRTDPDLANIRK 295

Query: 67 SPKFTPLIDKYDEPFINENAV 5
S +F PL+ ++DE FINENA+
Sbjct: 296 SEEFEPLLKRFDESFINENAI 316


>tr|A5AKU0|A5AKU0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_041015 PE=4 SV=1
Length = 1051

Score = 120 bits (301), Expect = 3e-26
Identities = 52/81 (64%), Positives = 71/81 (87%)
Frame = -3

Query: 247 VLGAKPEYKEEAVANYNIACCYSKLNEVEAGLSALEAAMEAGFEDYKTVRSDPDLANLRV 68
VLG+KP+ E + A+YN+ACCYSKLN+++AGLSALE A+EAG+ED+KT+R+DPDLAN+R
Sbjct: 958 VLGSKPDPNEASAASYNVACCYSKLNQIQAGLSALEDALEAGYEDFKTIRTDPDLANIRK 1017

Query: 67 SPKFTPLIDKYDEPFINENAV 5
S +F PL+ ++DE FINENA+
Sbjct: 1018 SEEFEPLLKRFDESFINENAI 1038


>tr|B7FKN6|B7FKN6_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 335

Score = 119 bits (297), Expect = 1e-25
Identities = 52/81 (64%), Positives = 69/81 (85%)
Frame = -3

Query: 247 VLGAKPEYKEEAVANYNIACCYSKLNEVEAGLSALEAAMEAGFEDYKTVRSDPDLANLRV 68
VLG+KPE E AVA+YN+ACCYSKLN+++A LS LE A+ +GFED+K +R+DPDLANLR
Sbjct: 243 VLGSKPEPDEAAVASYNVACCYSKLNQIQAALSTLEEALNSGFEDFKRIRTDPDLANLRA 302

Query: 67 SPKFTPLIDKYDEPFINENAV 5
SP+F PL+ ++DE FINE+A+
Sbjct: 303 SPEFDPLLKRFDESFINESAI 323


>tr|Q9AT39|Q9AT39_SOYBN SHOOT1 protein OS=Glycine max GN=SHOOT1 PE=2
SV=1
Length = 359

Score = 116 bits (290), Expect = 6e-25
Identities = 50/81 (61%), Positives = 68/81 (83%)
Frame = -3

Query: 247 VLGAKPEYKEEAVANYNIACCYSKLNEVEAGLSALEAAMEAGFEDYKTVRSDPDLANLRV 68
+LG+KPE +E AVA+YN+ACCYSKLN+++A LS+LE A+ GFED+K +R+DPDLAN R
Sbjct: 267 ILGSKPEPEEAAVASYNVACCYSKLNQIQAALSSLEEALNTGFEDFKRIRTDPDLANARA 326

Query: 67 SPKFTPLIDKYDEPFINENAV 5
S +F PL+ ++DE FINENA+
Sbjct: 327 SEEFDPLLKRFDESFINENAI 347


>tr|Q9LKK3|Q9LKK3_ORYSA Putative tyrosine phosphatase (Fragment)
OS=Oryza sativa PE=2 SV=1
Length = 240

Score = 114 bits (286), Expect = 2e-24
Identities = 49/81 (60%), Positives = 69/81 (85%)
Frame = -3

Query: 247 VLGAKPEYKEEAVANYNIACCYSKLNEVEAGLSALEAAMEAGFEDYKTVRSDPDLANLRV 68
VLG+KPE E ++A+YN+ACCYSKL+ ++AG+SALE A++AG+ED+K +R+DPDL NLR
Sbjct: 148 VLGSKPEINESSIASYNVACCYSKLDRIQAGISALEDALKAGYEDFKRIRTDPDLENLRK 207

Query: 67 SPKFTPLIDKYDEPFINENAV 5
+ +F L++KYDE FINENA+
Sbjct: 208 TEEFNVLLNKYDESFINENAI 228


>tr|Q710P9|Q710P9_ORYSA Putative tyrosine phosphatase (Fragment)
OS=Oryza sativa GN=xd9 PE=2 SV=1
Length = 111

Score = 114 bits (286), Expect = 2e-24
Identities = 49/81 (60%), Positives = 69/81 (85%)
Frame = -3

Query: 247 VLGAKPEYKEEAVANYNIACCYSKLNEVEAGLSALEAAMEAGFEDYKTVRSDPDLANLRV 68
VLG+KPE E ++A+YN+ACCYSKL+ ++AG+SALE A++AG+ED+K +R+DPDL NLR
Sbjct: 19 VLGSKPEINESSIASYNVACCYSKLDRIQAGISALEDALKAGYEDFKRIRTDPDLENLRK 78

Query: 67 SPKFTPLIDKYDEPFINENAV 5
+ +F L++KYDE FINENA+
Sbjct: 79 TEEFNVLLNKYDESFINENAI 99


>tr|Q69LC1|Q69LC1_ORYSJ Os07g0171100 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0050F10.39-1 PE=4 SV=1
Length = 219

Score = 114 bits (286), Expect = 2e-24
Identities = 49/81 (60%), Positives = 69/81 (85%)
Frame = -3

Query: 247 VLGAKPEYKEEAVANYNIACCYSKLNEVEAGLSALEAAMEAGFEDYKTVRSDPDLANLRV 68
VLG+KPE E ++A+YN+ACCYSKL+ ++AG+SALE A++AG+ED+K +R+DPDL NLR
Sbjct: 127 VLGSKPEINESSIASYNVACCYSKLDRIQAGISALEDALKAGYEDFKRIRTDPDLENLRK 186

Query: 67 SPKFTPLIDKYDEPFINENAV 5
+ +F L++KYDE FINENA+
Sbjct: 187 TEEFNVLLNKYDESFINENAI 207


>tr|Q69LC0|Q69LC0_ORYSJ cDNA clone:001-045-E07, full insert sequence
OS=Oryza sativa subsp. japonica GN=OSJNBa0050F10.39-2
PE=2 SV=1
Length = 335

Score = 114 bits (286), Expect = 2e-24
Identities = 49/81 (60%), Positives = 69/81 (85%)
Frame = -3

Query: 247 VLGAKPEYKEEAVANYNIACCYSKLNEVEAGLSALEAAMEAGFEDYKTVRSDPDLANLRV 68
VLG+KPE E ++A+YN+ACCYSKL+ ++AG+SALE A++AG+ED+K +R+DPDL NLR
Sbjct: 243 VLGSKPEINESSIASYNVACCYSKLDRIQAGISALEDALKAGYEDFKRIRTDPDLENLRK 302

Query: 67 SPKFTPLIDKYDEPFINENAV 5
+ +F L++KYDE FINENA+
Sbjct: 303 TEEFNVLLNKYDESFINENAI 323