BP911613
Clone id YMU001_000007_B02
Library
Length 456
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000007_B02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CACCGTCTTCTTTGTCCATTGCAAAAGTATGCACAACTTGTCACTGCCTTTTCTTGGTAA
GAACACAAAGTTGAGGTAAGTGGTTTGACAGCATTATCTGAAAGGGTTTTGCATATAGTT
GTAACGCCATCCATTACTACCGTATCCTGATGGTCCACAACACCCCAAGCTTCTGTCTTT
CCCCTTCAAACGTACCAAGTGTCTCATCAATGAAATAAGCCAAGAAATGCTAAAGGGCCA
GGGTTCTTGCAATGCTCTCCAAGCTGGCCATGTCCACATCTGCCATTTTTTCAATGTTCT
CCAAGTTGGCCATGTCCATGTCTGCTCGTCCACCCCCCATCCACCGAACTCCTCTTGGAC
TCTGGACCCTTTCGGGTTTCACTTTCTTCAGTTTCTCCAGCAGAAGGCTTCCTACTTTCA
CGAGCTCTATTGATACCCCACCCAATTTTTCCGTAC
■■Homology search results ■■ -
sp_hit_id Q502B3
Definition sp|Q502B3|B3GL2_DANRE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2 OS=Danio rerio
Align length 122
Score (bit) 35.8
E-value 0.091
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911613|Adiantum capillus-veneris mRNA, clone:
YMU001_000007_B02.
(456 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q502B3|B3GL2_DANRE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyl... 36 0.091
sp|O60885|BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sa... 31 2.2
sp|Q9H987|SYP2L_HUMAN Synaptopodin 2-like protein OS=Homo sapien... 31 2.3
sp|P45561|AMEL_PIG Amelogenin OS=Sus scrofa GN=AMEL PE=1 SV=2 31 2.3
sp|Q5TM83|NANOG_MUSMM Homeobox protein NANOG OS=Mus musculus mol... 31 2.9
sp|Q80Z64|NANOG_MOUSE Homeobox protein NANOG OS=Mus musculus GN=... 31 2.9
sp|Q309Z6|HIF1A_EOSBA Hypoxia-inducible factor 1 alpha OS=Eospal... 30 3.8
sp|P09195|F16P1_WHEAT Fructose-1,6-bisphosphatase, chloroplastic... 30 3.8
sp|Q21VE7|KUP2_RHOFD Probable potassium transport system protein... 30 3.8
sp|Q6MG11|CF134_RAT UPF0635 protein C6orf134 homolog OS=Rattus n... 30 3.8
sp|Q8K341|CF134_MOUSE UPF0635 protein C6orf134 homolog OS=Mus mu... 30 3.8
sp|Q5SQI0|CF134_HUMAN UPF0635 protein C6orf134 OS=Homo sapiens G... 30 3.8
sp|O35800|HIF1A_RAT Hypoxia-inducible factor 1 alpha OS=Rattus n... 30 4.9
sp|O71070|ADEN_ADEBA Adenain OS=Bovine adenovirus C serotype 10 ... 30 4.9
sp|A7H902|KUP_ANADF Probable potassium transport system protein ... 28 5.6
sp|Q61221|HIF1A_MOUSE Hypoxia-inducible factor 1 alpha OS=Mus mu... 30 6.4
sp|Q16665|HIF1A_HUMAN Hypoxia-inducible factor 1 alpha OS=Homo s... 30 6.4
sp|Q9XTA5|HIF1A_BOVIN Hypoxia-inducible factor 1 alpha OS=Bos ta... 30 6.4
sp|Q0PGG7|HIF1A_BOSMU Hypoxia-inducible factor 1 alpha OS=Bos mu... 30 6.4
sp|Q9ESU6|BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus mus... 30 6.4
sp|Q2GNY7|YPI1_CHAGB Type 1 phosphatases regulator YPI1 OS=Chaet... 29 8.4
sp|Q810H6|DISC1_RAT Disrupted in schizophrenia 1 homolog OS=Ratt... 29 8.4
sp|P33484|COA1_PAVP9 Coat protein VP1 OS=Porcine parvovirus (str... 29 8.4
sp|B1AQ75|KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus muscu... 29 8.6
sp|Q861X8|AMELY_PANTR Amelogenin, Y isoform (Fragment) OS=Pan tr... 29 8.6

>sp|Q502B3|B3GL2_DANRE
UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2
OS=Danio rerio GN=b3galnt2 PE=2 SV=1
Length = 491

Score = 35.8 bits (81), Expect = 0.091
Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 11/122 (9%)
Frame = -1

Query: 339 WGVDEQTWTWPTWRTLKKWQMWTW--PAWRALQEPWPFSIS-----WLISLMRHLVRLKG 181
WG Q W + KWQ + PA+ A + +S WL S +HL +G
Sbjct: 375 WGNFRQNWAVDR---VGKWQELEYASPAYPAFACGSGYVVSRDLVQWLASNAQHLKAYQG 431

Query: 180 KDRSLG----CCGPSGYGSNGWRYNYMQNPFR*CCQTTYLNFVFLPRKGSDKLCILLQWT 13
+D S+G GP Y +GW C + Y++ + P+ +++L +L W+
Sbjct: 432 EDVSMGIWMAAVGPRKYQDSGWL----------CEKECYVDMLSSPQHSAEELRLL--WS 479

Query: 12 KK 7
+K
Sbjct: 480 RK 481


>sp|O60885|BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo
sapiens GN=BRD4 PE=1 SV=2
Length = 1362

Score = 31.2 bits (69), Expect = 2.2
Identities = 13/44 (29%), Positives = 24/44 (54%)
Frame = -2

Query: 443 GWGINRARESRKPSAGETEESETRKGPESKRSSVDGGWTSRHGH 312
G+ + + S + S+ ++E+SET P+SK+ G +H H
Sbjct: 697 GFSSSESESSSESSSSDSEDSETEMAPKSKKKGHPGREQKKHHH 740


>sp|Q9H987|SYP2L_HUMAN Synaptopodin 2-like protein OS=Homo sapiens
GN=SYNPO2L PE=2 SV=3
Length = 977

Score = 31.2 bits (69), Expect = 2.3
Identities = 23/75 (30%), Positives = 30/75 (40%), Gaps = 7/75 (9%)
Frame = +1

Query: 244 FLQCSPSWPCPHLP-------FFQCSPSWPCPCLLVHPPSTELLLDSGPFRVSLSSVSPA 402
+L SP+ P P +P SPSW L PP+ LLL GP R
Sbjct: 176 YLSDSPAEPAPTIPGPPSQGDSRVSSPSWEDGAALQPPPAEALLLPHGPLRPG------- 228

Query: 403 EGFLLSRALLIPHPI 447
L+ +PHP+
Sbjct: 229 -PHLIPMVGPVPHPV 242


>sp|P45561|AMEL_PIG Amelogenin OS=Sus scrofa GN=AMEL PE=1 SV=2
Length = 189

Score = 31.2 bits (69), Expect = 2.3
Identities = 24/64 (37%), Positives = 26/64 (40%), Gaps = 5/64 (7%)
Frame = +1

Query: 163 PQASVFPL-----QTYQVSHQ*NKPRNAKGPGFLQCSPSWPCPHLPFFQCSPSWPCPCLL 327
PQ + PL T HQ N P A+ P Q P P PH P SP P LL
Sbjct: 97 PQQPMMPLPGQHSMTPTQHHQPNLPLPAQQP--FQPQPVQPQPHQPLQPQSPMHPIQPLL 154

Query: 328 VHPP 339
PP
Sbjct: 155 PQPP 158


>sp|Q5TM83|NANOG_MUSMM Homeobox protein NANOG OS=Mus musculus
molossinus GN=Nanog PE=2 SV=1
Length = 305

Score = 30.8 bits (68), Expect = 2.9
Identities = 14/27 (51%), Positives = 15/27 (55%)
Frame = -1

Query: 339 WGVDEQTWTWPTWRTLKKWQMWTWPAW 259
WG QTWT PTW + Q WT P W
Sbjct: 198 WG--SQTWTNPTWSS----QTWTNPTW 218



Score = 30.0 bits (66), Expect = 5.0
Identities = 13/31 (41%), Positives = 17/31 (54%)
Frame = -1

Query: 330 DEQTWTWPTWRTLKKWQMWTWPAWRALQEPW 238
+ QTWT PTW + Q WT +W +PW
Sbjct: 219 NNQTWTNPTWSS----QAWTAQSWNG--QPW 243


>sp|Q80Z64|NANOG_MOUSE Homeobox protein NANOG OS=Mus musculus
GN=Nanog PE=1 SV=1
Length = 305

Score = 30.8 bits (68), Expect = 2.9
Identities = 14/27 (51%), Positives = 15/27 (55%)
Frame = -1

Query: 339 WGVDEQTWTWPTWRTLKKWQMWTWPAW 259
WG QTWT PTW + Q WT P W
Sbjct: 198 WG--SQTWTNPTWSS----QTWTNPTW 218



Score = 30.0 bits (66), Expect = 5.0
Identities = 13/31 (41%), Positives = 17/31 (54%)
Frame = -1

Query: 330 DEQTWTWPTWRTLKKWQMWTWPAWRALQEPW 238
+ QTWT PTW + Q WT +W +PW
Sbjct: 219 NNQTWTNPTWSS----QAWTAQSWNG--QPW 243


>sp|Q309Z6|HIF1A_EOSBA Hypoxia-inducible factor 1 alpha OS=Eospalax
baileyi GN=HIF1A PE=2 SV=1
Length = 819

Score = 30.4 bits (67), Expect = 3.8
Identities = 28/105 (26%), Positives = 36/105 (34%), Gaps = 10/105 (9%)
Frame = +2

Query: 140 PYPDGPQHPKLLSFPFKRTKCLINEISQEMLKGQGSCNALQA-GHVHI---------CHF 289
P G + SF F R KC + + M + L GH+H+ C +
Sbjct: 155 PIKKGKEQNTQRSF-FLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGY 213

Query: 290 FNVLQVGHVHVCSSTPHPPNSSWTLDPFGFHFLQFLQQKASYFHE 424
V +C PHP N LD F L K SY E
Sbjct: 214 KKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDE 258


>sp|P09195|F16P1_WHEAT Fructose-1,6-bisphosphatase, chloroplastic
OS=Triticum aestivum GN=FBP PE=2 SV=1
Length = 409

Score = 30.4 bits (67), Expect = 3.8
Identities = 15/49 (30%), Positives = 26/49 (53%)
Frame = -2

Query: 200 TWYV*RGKTEAWGVVDHQDTVVMDGVTTICKTLSDNAVKPLTSTLCSYQ 54
TW + K E GV+D++ T+V+ ++T CK ++ + S L Q
Sbjct: 78 TWLL---KQEQEGVIDNEMTIVLSSISTACKQIASLVQRAPISNLTGVQ 123


>sp|Q21VE7|KUP2_RHOFD Probable potassium transport system protein
kup 2 OS=Rhodoferax ferrireducens (strain DSM 15236 /
ATCC BAA-621 / T118) GN=kup2 PE=3 SV=1
Length = 625

Score = 30.4 bits (67), Expect = 3.8
Identities = 18/44 (40%), Positives = 26/44 (59%)
Frame = +1

Query: 85 LTALSERVLHIVVTPSITTVS*WSTTPQASVFPLQTYQVSHQ*N 216
+TALS V+H V ++ TV+ T PQA + L+ QV H+ N
Sbjct: 465 ITALSADVVHRVPRTAVYTVANPDTVPQALMHNLKHNQVLHERN 508


>sp|Q6MG11|CF134_RAT UPF0635 protein C6orf134 homolog OS=Rattus
norvegicus PE=2 SV=1
Length = 421

Score = 30.4 bits (67), Expect = 3.8
Identities = 23/78 (29%), Positives = 30/78 (38%), Gaps = 2/78 (2%)
Frame = +1

Query: 217 KPRNAKGPGFLQCS--PSWPCPHLPFFQCSPSWPCPCLLVHPPSTELLLDSGPFRVSLSS 390
KP ++ FL+ + P WP P P+ HPP L + P R L
Sbjct: 233 KPYSSSDREFLKVAVEPPWPLNRAPRRATPPA--------HPPPRSSSLGNSPDRGPLRP 284

Query: 391 VSPAEGFLLSRALLIPHP 444
P + L S L PHP
Sbjct: 285 FVPEQELLRSLRLCPPHP 302


tr_hit_id A6VAL6
Definition tr|A6VAL6|A6VAL6_PSEA7 Putative uncharacterized protein OS=Pseudomonas aeruginosa (strain PA7)
Align length 75
Score (bit) 42.0
E-value 0.015
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911613|Adiantum capillus-veneris mRNA, clone:
YMU001_000007_B02.
(456 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A6VAL6|A6VAL6_PSEA7 Putative uncharacterized protein OS=Pseud... 42 0.015
tr|A5K0Y1|A5K0Y1_PLAVI Putative uncharacterized protein OS=Plasm... 40 0.044
tr|A3LLX5|A3LLX5_PSEAE Putative uncharacterized protein OS=Pseud... 39 0.13
tr|A3L534|A3L534_PSEAE Putative uncharacterized protein OS=Pseud... 39 0.13
tr|Q8U451|Q8U451_PYRFU Putative uncharacterized protein PF0244 O... 30 0.14
tr|Q02HR2|Q02HR2_PSEAB Putative uncharacterized protein OS=Pseud... 37 0.37
tr|Q2CKD5|Q2CKD5_9RHOB Saccharopine dehydrogenase (NAD+, L-lysin... 36 0.83
tr|Q6ZVB8|Q6ZVB8_HUMAN cDNA FLJ42789 fis, clone BRAWH3007221 OS=... 36 1.1
tr|Q0U2L8|Q0U2L8_PHANO Putative uncharacterized protein OS=Phaeo... 35 1.4
tr|A1X158|A1X158_PERVI Foot protein 1 variant 1 OS=Perna viridis... 35 1.9
tr|Q21UE1|Q21UE1_RHOFD Putative inner membrane transmembrane pro... 35 2.4
tr|Q2B2Z1|Q2B2Z1_9BACI FimV protein OS=Bacillus sp. NRRL B-14911... 35 2.4
tr|A6E4H9|A6E4H9_9RHOB Saccharopine dehydrogenase, putative OS=R... 35 2.4
tr|B5B0G9|B5B0G9_PERVI Foot protein 1 variant 2 OS=Perna viridis... 35 2.4
tr|A1X159|A1X159_PERVI Foot protein 1 variant 2 OS=Perna viridis... 35 2.4
tr|B7ZZ41|B7ZZ41_MAIZE Putative uncharacterized protein OS=Zea m... 35 2.4
tr|A3VXP5|A3VXP5_9RHOB Saccharopine dehydrogenase, putative OS=R... 34 3.2
tr|B4N845|B4N845_DROWI GK11989 OS=Drosophila willistoni GN=GK119... 34 3.2
tr|A7T5B1|A7T5B1_NEMVE Predicted protein OS=Nematostella vectens... 34 3.2
tr|B6IHJ3|B6IHJ3_CAEBR Putative uncharacterized protein OS=Caeno... 34 4.1
tr|A3K517|A3K517_9RHOB Saccharopine dehydrogenase, putative OS=S... 33 5.4
tr|Q9UAY0|Q9UAY0_CAEEL Putative uncharacterized protein OS=Caeno... 33 5.4
tr|Q4PHE7|Q4PHE7_USTMA Putative uncharacterized protein OS=Ustil... 33 5.4
tr|A8UGP0|A8UGP0_9FLAO Putative uncharacterized protein OS=Flavo... 33 7.1
tr|A1S555|A1S555_SHEAM Putative uncharacterized protein OS=Shewa... 33 7.1
tr|Q56PB8|Q56PB8_PIG RPGR (Fragment) OS=Sus scrofa PE=2 SV=1 33 7.1
tr|A4A1E4|A4A1E4_9PLAN Probable mu-protocadherin-putative cell-s... 33 9.2
tr|Q2QR52|Q2QR52_ORYSJ Os12g0472800 protein OS=Oryza sativa subs... 33 9.2
tr|A3CH86|A3CH86_ORYSJ Putative uncharacterized protein OS=Oryza... 33 9.2
tr|A4H4P0|A4H4P0_LEIBR Putative uncharacterized protein OS=Leish... 33 9.2

>tr|A6VAL6|A6VAL6_PSEA7 Putative uncharacterized protein
OS=Pseudomonas aeruginosa (strain PA7) GN=PSPA7_4758
PE=4 SV=1
Length = 150

Score = 42.0 bits (97), Expect = 0.015
Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 8/75 (10%)
Frame = -1

Query: 348 FGGWGVDEQTWTW--PTWRTLKK----WQMWT-WPAWRALQ-EPWPFSISWLISLMRHLV 193
+GGWG+ Q +R L+ WQ+W+ W+A+Q P ++ WLI L V
Sbjct: 53 YGGWGLQRQVLLRGPQAFRGLRHDERGWQLWSAGSGWQAVQLRPDSLALPWLIVLR---V 109

Query: 192 RLKGKDRSLGCCGPS 148
RL G R+LGCC P+
Sbjct: 110 RLPGGWRTLGCCIPA 124


>tr|A5K0Y1|A5K0Y1_PLAVI Putative uncharacterized protein OS=Plasmodium
vivax GN=PVX_085195 PE=4 SV=1
Length = 2053

Score = 40.4 bits (93), Expect = 0.044
Identities = 28/71 (39%), Positives = 33/71 (46%), Gaps = 6/71 (8%)
Frame = -2

Query: 428 RARESRKPSAGETEESETRKGPESKRSSVDGGWTSRHGH--GQLGEH*KNGRCGHGQLGE 255
R R R+ S + R GP +RS +G SR G GQ G+ KN R G G LGE
Sbjct: 1545 RGRGRRRSSRSRSSRKGERSGPGGERSGQNGEKNSRGGEESGQSGK--KNSRGGDGNLGE 1602

Query: 254 ----HCKNPGP 234
C NP P
Sbjct: 1603 ATPPGCPNPSP 1613


>tr|A3LLX5|A3LLX5_PSEAE Putative uncharacterized protein
OS=Pseudomonas aeruginosa 2192 GN=PA2G_05897 PE=4 SV=1
Length = 150

Score = 38.9 bits (89), Expect = 0.13
Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 8/75 (10%)
Frame = -1

Query: 348 FGGWGVDEQTWTWPT--WRTLKK----WQMWT-WPAWRALQ-EPWPFSISWLISLMRHLV 193
+G WG+ Q + +R L+ WQ+W+ W+A+Q P ++ WLI L V
Sbjct: 53 YGAWGLYRQVLLRGSRAFRGLRHDERGWQLWSAGSGWQAVQLRPDSLALPWLIVLR---V 109

Query: 192 RLKGKDRSLGCCGPS 148
RL G+ R LGCC P+
Sbjct: 110 RLPGRWRILGCCIPA 124


>tr|A3L534|A3L534_PSEAE Putative uncharacterized protein
OS=Pseudomonas aeruginosa C3719 GN=PACG_05306 PE=4 SV=1
Length = 150

Score = 38.9 bits (89), Expect = 0.13
Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 8/75 (10%)
Frame = -1

Query: 348 FGGWGVDEQTWTWPT--WRTLKK----WQMWT-WPAWRALQ-EPWPFSISWLISLMRHLV 193
+G WG+ Q + +R L+ WQ+W+ W+A+Q P ++ WLI L V
Sbjct: 53 YGAWGLYRQVLLRGSRAFRGLRHDERGWQLWSAGSGWQAVQLRPDSLALPWLIVLR---V 109

Query: 192 RLKGKDRSLGCCGPS 148
RL G+ R LGCC P+
Sbjct: 110 RLPGRWRILGCCIPA 124


>tr|Q8U451|Q8U451_PYRFU Putative uncharacterized protein PF0244
OS=Pyrococcus furiosus GN=PF0244 PE=4 SV=1
Length = 84

Score = 30.4 bits (67), Expect(2) = 0.14
Identities = 10/23 (43%), Positives = 15/23 (65%)
Frame = -1

Query: 276 WTWPAWRALQEPWPFSISWLISL 208
WTWP W A+ + ++SWL+ L
Sbjct: 27 WTWPTWHAMITDYHPAMSWLMPL 49



Score = 28.5 bits (62), Expect(2) = 0.14
Identities = 8/14 (57%), Positives = 10/14 (71%)
Frame = -1

Query: 333 VDEQTWTWPTWRTL 292
VD+ WTWPTW +
Sbjct: 22 VDQWNWTWPTWHAM 35


>tr|Q02HR2|Q02HR2_PSEAB Putative uncharacterized protein
OS=Pseudomonas aeruginosa (strain UCBPP-PA14)
GN=PA14_54460 PE=4 SV=1
Length = 150

Score = 37.4 bits (85), Expect = 0.37
Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 8/75 (10%)
Frame = -1

Query: 348 FGGWGVDEQTWTWPT--WRTLKK----WQMWT-WPAWRALQ-EPWPFSISWLISLMRHLV 193
+G WG+ Q + +R L+ WQ+W+ W+A+Q P ++ WLI L V
Sbjct: 53 YGAWGLYRQVLLRGSRAFRGLRHDEQGWQLWSAGSGWQAVQLRPDSLALPWLIVLR---V 109

Query: 192 RLKGKDRSLGCCGPS 148
RL G+ R GCC P+
Sbjct: 110 RLPGRWRIFGCCIPA 124


>tr|Q2CKD5|Q2CKD5_9RHOB Saccharopine dehydrogenase (NAD+, L-lysine
forming) OS=Oceanicola granulosus HTCC2516
GN=OG2516_10341 PE=4 SV=1
Length = 345

Score = 36.2 bits (82), Expect = 0.83
Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 2/75 (2%)
Frame = +1

Query: 220 PRNAKGPGFLQCSPSWPCPHLPFFQCSPSWPCPCLLVH--PPSTELLLDSGPFRVSLSSV 393
PR + G + C P P +P + + W P L VH PP + +D+ P + +
Sbjct: 251 PRRLRVIGDVACDPGTPYNPIPLYDAATGWDAPALRVHDTPPLDIMAIDNLPSLLPAEAS 310

Query: 394 SPAEGFLLSRALLIP 438
+ LL L +P
Sbjct: 311 TEFAADLLEHLLQLP 325


>tr|Q6ZVB8|Q6ZVB8_HUMAN cDNA FLJ42789 fis, clone BRAWH3007221
OS=Homo sapiens PE=2 SV=1
Length = 163

Score = 35.8 bits (81), Expect = 1.1
Identities = 22/53 (41%), Positives = 27/53 (50%), Gaps = 5/53 (9%)
Frame = +1

Query: 262 SWPCPHLPFFQCSPSWPCPCLLVHPPSTELLLDSGPFRVSLS-----SVSPAE 405
S PCP LP P P L HPP + LL S P +S+S SVSP++
Sbjct: 16 STPCPQLPLLA-----PVPAFLSHPPVSIFLLCSHPLSLSVSLLFLFSVSPSD 63


>tr|Q0U2L8|Q0U2L8_PHANO Putative uncharacterized protein
OS=Phaeosphaeria nodorum GN=SNOG_14015 PE=4 SV=2
Length = 128

Score = 35.4 bits (80), Expect = 1.4
Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 3/63 (4%)
Frame = -1

Query: 330 DEQTWTWP-TWRTLKKWQMWTWPAWRAL--QEPWPFSISWLISLMRHLVRLKGKDRSLGC 160
D + W W ++ L + W A+RA+ Q W F+ WLI H +R+K KD+S+
Sbjct: 44 DTKAWGWNVSYTPLSTYGPGKWEAYRAVAHQNGW-FNDLWLIWQREHWLRIKAKDKSMRT 102

Query: 159 CGP 151
P
Sbjct: 103 VEP 105


>tr|A1X158|A1X158_PERVI Foot protein 1 variant 1 OS=Perna viridis
GN=fp-1 PE=2 SV=1
Length = 561

Score = 35.0 bits (79), Expect = 1.9
Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 14/48 (29%)
Frame = -1

Query: 339 WGVDEQTWT--------WPTWR-TLKKWQMWT-----WPAWRALQEPW 238
W + WT W W+ TLK W W W AW+A +PW
Sbjct: 99 WKATPKPWTAWKAPPPAWTAWKATLKPWTAWKATPKPWTAWKATPKPW 146



Score = 34.7 bits (78), Expect = 2.4
Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 14/48 (29%)
Frame = -1

Query: 339 WGVDEQTWT--------WPTWR-TLKKWQMW-----TWPAWRALQEPW 238
W + WT W W+ T K W W TW AW+A +PW
Sbjct: 59 WKATPKPWTAWKAPPPAWTAWKATPKPWTAWKAPPPTWTAWKATPKPW 106



Score = 34.7 bits (78), Expect = 2.4
Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 14/48 (29%)
Frame = -1

Query: 339 WGVDEQTWT--------WPTWR-TLKKWQMW-----TWPAWRALQEPW 238
W + WT W W+ T K W W TW AW+A +PW
Sbjct: 249 WKATPKPWTAWKAPPPAWTAWKATPKPWTAWKAPPPTWTAWKATPKPW 296



Score = 33.9 bits (76), Expect = 4.1
Identities = 16/48 (33%), Positives = 19/48 (39%), Gaps = 14/48 (29%)
Frame = -1

Query: 339 WGVDEQTWT--------WPTWR-TLKKWQMW-----TWPAWRALQEPW 238
W V WT W W+ T K W W W AW+A +PW
Sbjct: 349 WKVPPPAWTAWKAHPPAWTAWKATPKPWTAWKAPPPAWTAWKATPKPW 396



Score = 33.1 bits (74), Expect = 7.1
Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 14/48 (29%)
Frame = -1

Query: 339 WGVDEQTWT--------WPTWR-TLKKWQMWT-----WPAWRALQEPW 238
W + WT W W+ T K W +W W AW+A +PW
Sbjct: 149 WKATPKPWTAWKATPKPWTAWKATPKPWTVWKATPKPWTAWKATPKPW 196



Score = 33.1 bits (74), Expect = 7.1
Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 14/48 (29%)
Frame = -1

Query: 339 WGVDEQTWT--------WPTWR-TLKKWQMWT-----WPAWRALQEPW 238
W + WT W W+ T K W +W W AW+A +PW
Sbjct: 189 WKATPKPWTAWKAPPPAWSAWKATPKPWTVWKATPKPWTAWKATPKPW 236



Score = 33.1 bits (74), Expect = 7.1
Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 6/32 (18%)
Frame = -1

Query: 315 TWPTWR-TLKKWQMW-----TWPAWRALQEPW 238
TW W+ T K W W W AW+A +PW
Sbjct: 285 TWTAWKATPKPWTAWKAPPPAWSAWKATPKPW 316



Score = 32.7 bits (73), Expect = 9.2
Identities = 15/48 (31%), Positives = 19/48 (39%), Gaps = 14/48 (29%)
Frame = -1

Query: 339 WGVDEQTWT--------WPTWR-TLKKWQMW-----TWPAWRALQEPW 238
W + WT W W+ T K W W W AW+A +PW
Sbjct: 169 WKATPKPWTVWKATPKPWTAWKATPKPWTAWKAPPPAWSAWKATPKPW 216



Score = 32.7 bits (73), Expect = 9.2
Identities = 15/48 (31%), Positives = 19/48 (39%), Gaps = 14/48 (29%)
Frame = -1

Query: 339 WGVDEQTWT--------WPTWR-TLKKWQMW-----TWPAWRALQEPW 238
W + WT W W+ T K W W W AW+A +PW
Sbjct: 369 WKATPKPWTAWKAPPPAWTAWKATPKPWTAWKAPPPAWTAWKATPKPW 416