BP911620
Clone id YMU001_000007_B10
Library
Length 526
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000007_B10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCTTAAAACTCTTTCAAGAACCATACAGAAGATCCTTCTAGAAGAAGGTCTGAAAAGAAA
GATCCAACAAACATCCATCTCTCCTAAGGTAAATATAGTCTGCTTGCAACCTTCCAGGCA
AGCACACCACAACAGATGATCTAAGAAATTATCATGTTAAAACCACCAACACCCAAGAAT
CAAAATAATAAATCTGCAGCTAGCCCTCTAATAGTTTGTGTTGCTCACAGTCTCTTTTTC
TCTCGCATTACTTGGAATTCATAAAAAAGCTGAGTAACACCAAGCTCCTAAATGAATAGC
AATTATAACCTGCATGATGCATCCAGAAATTCTACCTACTCAAATTAGCCACAAAGAGAT
TACATATAAGTCGAAATCCAGTAAAAAATGATTGCAACCCTAAAATATGAAATATGCCAC
GATCCTGCATCAATCAATCTAGCTAATTTGAGCTCTAAACAAGACTTCCTTCTACACACT
ACTAGCAGCCATATGCAACTACTGCACATTACTAGCGATATTAGTT
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911620|Adiantum capillus-veneris mRNA, clone:
YMU001_000007_B10.
(526 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id Q0CH26
Definition tr|Q0CH26|Q0CH26_ASPTN Putative uncharacterized protein OS=Aspergillus terreus (strain NIH 2624)
Align length 61
Score (bit) 33.9
E-value 5.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911620|Adiantum capillus-veneris mRNA, clone:
YMU001_000007_B10.
(526 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q0CH26|Q0CH26_ASPTN Putative uncharacterized protein OS=Asper... 34 5.2
tr|B8LUD0|B8LUD0_9EURO Fungal specific transcription factor, put... 33 6.7

>tr|Q0CH26|Q0CH26_ASPTN Putative uncharacterized protein
OS=Aspergillus terreus (strain NIH 2624) GN=ATEG_07016
PE=4 SV=1
Length = 439

Score = 33.9 bits (76), Expect = 5.2
Identities = 21/61 (34%), Positives = 27/61 (44%)
Frame = +1

Query: 52 EKKDPTNIHLS*GKYSLLATFQASTPQQMI*EIIMLKPPTPKNQNNKSAASPLIVCVAHS 231
E+ DPT +SLL F+A TP + PPTP+ + A SP C S
Sbjct: 237 ERSDPTPCMAIGPSWSLLTAFRALTPISTC-----MPPPTPQPMRRRLARSPATPCPGRS 291

Query: 232 L 234
L
Sbjct: 292 L 292


>tr|B8LUD0|B8LUD0_9EURO Fungal specific transcription factor, putative
OS=Talaromyces stipitatus ATCC 10500 GN=TSTA_071060 PE=4
SV=1
Length = 1044

Score = 33.5 bits (75), Expect = 6.7
Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 2/71 (2%)
Frame = +1

Query: 7 NSFKNHTEDPSRRRSEKKD--PTNIHLS*GKYSLLATFQASTPQQMI*EIIMLKPPTPKN 180
NS++NH + R K P+ + S+ ++ AS P M I +PP P+N
Sbjct: 893 NSYRNHFMFANYFRQTTKSLRPSTLRFISSTSSMSSSSSASAPN-MTPTIASTEPPNPEN 951

Query: 181 QNNKSAASPLI 213
NN SPL+
Sbjct: 952 TNNSEKKSPLL 962