BP911634
Clone id YMU001_000007_D02
Library
Length 407
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000007_D02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGAGTAGCTGCGTCCTTGGACCCCGACGGCTTCTTTGGCAAACATGATCCTCACGTGATG
ACCTTTTAGGTCTTCCTATTGTTAGCAGTCTGAGTTTACCAATAGTGTGATTATCTTTAT
GTCTCAAGTTCCATGAGATTCAGGTTTGCTATTCATTTATAGAGGAAGCAATTTTACTCT
AGGTTGTCTCAAATTTCTTTCTTGTGGTACTCATTCTCTTTTCCCAATATTGAGCGGGAG
GGGGAGTTCCTTCGGGGGAGTTCTCAGCTTCAGCTCTGGAGCTTTCAGTGACAATGTTTG
CTCTGTTCCGACGTGGGGTTGAGTCACTTGTTACCTCAGAGCGTACTTTTGAGGATACTT
CTATTTCAAAGGGGGATTCCAGGTTATTACCTTCAATTGACTTCCGC
■■Homology search results ■■ -
sp_hit_id Q9UK05
Definition sp|Q9UK05|GDF2_HUMAN Growth/differentiation factor 2 OS=Homo sapiens
Align length 42
Score (bit) 32.3
E-value 0.74
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911634|Adiantum capillus-veneris mRNA, clone:
YMU001_000007_D02.
(407 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9UK05|GDF2_HUMAN Growth/differentiation factor 2 OS=Homo sap... 32 0.74
sp|Q92349|MUG79_SCHPO Meiotically up-regulated gene 79 protein O... 32 1.3
sp|Q3T8J9|GON4L_HUMAN GON-4-like protein OS=Homo sapiens GN=GON4... 31 1.7
sp|Q9WV56|GDF2_MOUSE Growth/differentiation factor 2 OS=Mus musc... 31 1.7
sp|Q8WP21|CA062_MACFA Uncharacterized protein C1orf62 homolog OS... 31 1.7
sp|Q9LQM2|ATL1F_ARATH RING-H2 finger protein ATL1F OS=Arabidopsi... 31 2.2
sp|P26545|VE2_HPV5B Regulatory protein E2 OS=Human papillomaviru... 30 2.8
sp|Q9S7B5|THRC_ARATH Threonine synthase, chloroplastic OS=Arabid... 30 2.8
sp|Q8S0F0|FH1_ORYSJ Formin-like protein 1 OS=Oryza sativa subsp.... 30 4.8
sp|Q9CXL3|CG050_MOUSE Uncharacterized protein C7orf50 homolog OS... 30 4.8
sp|P38565|MUCB1_XENLA Integumentary mucin B.1 (Fragment) OS=Xeno... 29 6.3
sp|Q8BRN9|C2D1B_MOUSE Coiled-coil and C2 domain-containing prote... 29 6.3
sp|Q5S3G4|COX5B_PIG Cytochrome c oxidase subunit 5B, mitochondri... 29 8.2

>sp|Q9UK05|GDF2_HUMAN Growth/differentiation factor 2 OS=Homo
sapiens GN=GDF2 PE=1 SV=1
Length = 429

Score = 32.3 bits (72), Expect = 0.74
Identities = 16/42 (38%), Positives = 22/42 (52%)
Frame = -2

Query: 364 IEVSSKVRSEVTSDSTPRRNRANIVTESSRAEAENSPEGTPP 239
+EVSS V+ V SDST +N+ + ES R + PP
Sbjct: 205 LEVSSAVKRWVRSDSTKSKNKLEVTVESHRKGCDTLDISVPP 246


>sp|Q92349|MUG79_SCHPO Meiotically up-regulated gene 79 protein
OS=Schizosaccharomyces pombe GN=mug79 PE=1 SV=1
Length = 1318

Score = 31.6 bits (70), Expect = 1.3
Identities = 13/35 (37%), Positives = 26/35 (74%), Gaps = 2/35 (5%)
Frame = -2

Query: 382 LESPFEIE--VSSKVRSEVTSDSTPRRNRANIVTE 284
L+SPF + V +++ ++V D TP+RNR+++++E
Sbjct: 930 LKSPFAVPNAVQAQLHNQVRGDLTPKRNRSSLISE 964


>sp|Q3T8J9|GON4L_HUMAN GON-4-like protein OS=Homo sapiens GN=GON4L
PE=1 SV=1
Length = 2241

Score = 31.2 bits (69), Expect = 1.7
Identities = 27/94 (28%), Positives = 42/94 (44%), Gaps = 13/94 (13%)
Frame = -2

Query: 403 KSIEGNNLESPFEIEVSS-----KVRSEVTSDSTPRRNRANIVTESSRA--------EAE 263
++ E + LES E SS K R +S+ T + I++E+ + AE
Sbjct: 383 ETAEESLLESDVESTASSPRGAKKSRLRQSSEMTETDEESGILSEAEKVTTPAIRHISAE 442

Query: 262 NSPEGTPPPAQYWEKRMSTTRKKFETT*SKIASS 161
P G PPP + + R ST +K ++ASS
Sbjct: 443 VVPMGPPPPPKPKQTRDSTFMEKLHAVDEELASS 476


>sp|Q9WV56|GDF2_MOUSE Growth/differentiation factor 2 OS=Mus
musculus GN=Gdf2 PE=2 SV=1
Length = 428

Score = 31.2 bits (69), Expect = 1.7
Identities = 14/42 (33%), Positives = 22/42 (52%)
Frame = -2

Query: 364 IEVSSKVRSEVTSDSTPRRNRANIVTESSRAEAENSPEGTPP 239
+EVSS V+ V +DST +N+ + +S R + PP
Sbjct: 204 LEVSSAVKRWVRADSTTNKNKLEVTVQSHRESCDTLDISVPP 245


>sp|Q8WP21|CA062_MACFA Uncharacterized protein C1orf62 homolog
OS=Macaca fascicularis GN=QtsA-11775 PE=2 SV=1
Length = 759

Score = 31.2 bits (69), Expect = 1.7
Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
Frame = -2

Query: 361 EVSSKVRSEVTSDSTPRRNRANIVTESSR-AEAENSPEGTPPPAQYWEKRMSTTRKKF 191
E +S + V + + + NI+T++ + +NS +G PP Q+ EK S R K+
Sbjct: 192 ENTSDLEETVAAGDSSHQENVNILTKTKGPGDKQNSYQGQAPPKQHTEKASSGNRFKY 249


>sp|Q9LQM2|ATL1F_ARATH RING-H2 finger protein ATL1F OS=Arabidopsis
thaliana GN=ATL1F PE=2 SV=1
Length = 332

Score = 30.8 bits (68), Expect = 2.2
Identities = 21/65 (32%), Positives = 29/65 (44%)
Frame = -2

Query: 385 NLESPFEIEVSSKVRSEVTSDSTPRRNRANIVTESSRAEAENSPEGTPPPAQYWEKRMST 206
+LE P E+ VRSE+ + PR IV E + S E T Y E+RM
Sbjct: 206 SLEKPLEVPEIDLVRSEIHDEPLPRDTVTIIVHEEHPSTTIGSLEHTDEIESY-ERRMKA 264

Query: 205 TRKKF 191
+ +F
Sbjct: 265 SNLRF 269


>sp|P26545|VE2_HPV5B Regulatory protein E2 OS=Human papillomavirus
type 5b GN=E2 PE=3 SV=1
Length = 514

Score = 30.4 bits (67), Expect = 2.8
Identities = 26/116 (22%), Positives = 49/116 (42%), Gaps = 10/116 (8%)
Frame = -2

Query: 331 TSDSTPRRNRANIVTESSRAEAENSPEGTPPPAQYWEKRMSTTRKKFETT*SKIAS---- 164
T+ TP + + + S + P+ T + + +R S+ ++ +T + S
Sbjct: 215 TTAKTPTTSTTAVDSTSRQLTTSKQPQQTETRGRRYGRRPSSKSRRSQTQQRRSRSRHRS 274

Query: 163 -----SINE*QT*ISWNLRHKDNHTIGKLRLLTIGRPKRSSREDHVCQR-SRRGPR 14
S ++ QT +W+ + ++GK R LT R + R C+R R PR
Sbjct: 275 RSRSRSRSKSQTHTTWSTTRSRSTSVGKTRALT-SRSRSRGRSPSTCRRGGGRSPR 329


>sp|Q9S7B5|THRC_ARATH Threonine synthase, chloroplastic
OS=Arabidopsis thaliana GN=At4g29840 PE=1 SV=1
Length = 526

Score = 30.4 bits (67), Expect = 2.8
Identities = 15/39 (38%), Positives = 21/39 (53%)
Frame = -2

Query: 394 EGNNLESPFEIEVSSKVRSEVTSDSTPRRNRANIVTESS 278
+GNN+++P E V R+E RRNR+N V S
Sbjct: 42 DGNNIKAPIETAVKPPHRTEDNIRDEARRNRSNAVNPFS 80


>sp|Q8S0F0|FH1_ORYSJ Formin-like protein 1 OS=Oryza sativa subsp.
japonica GN=FH1 PE=2 SV=1
Length = 960

Score = 29.6 bits (65), Expect = 4.8
Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 3/54 (5%)
Frame = -2

Query: 364 IEVSSKVRSEVTSDSTPRRN---RANIVTESSRAEAENSPEGTPPPAQYWEKRM 212
IE +S +RS T+D+T RN + + P PPP YWE R+
Sbjct: 388 IENTSALRSTTTTDTTIPRNPFVQPPPPPTHTHGPPPPPPPPPPPPVGYWESRV 441


>sp|Q9CXL3|CG050_MOUSE Uncharacterized protein C7orf50 homolog
OS=Mus musculus PE=2 SV=2
Length = 195

Score = 29.6 bits (65), Expect = 4.8
Identities = 20/73 (27%), Positives = 37/73 (50%)
Frame = -2

Query: 406 RKSIEGNNLESPFEIEVSSKVRSEVTSDSTPRRNRANIVTESSRAEAENSPEGTPPPAQY 227
RK +EG ES + +++ + TS++ P + A+ + + E SPE +P +
Sbjct: 6 RKGLEGTGKESKRQ-KITPAEETRRTSEAGPDKETASTLVQ------EASPELSPEERRV 58

Query: 226 WEKRMSTTRKKFE 188
E+++ RKK E
Sbjct: 59 LERKLKKERKKEE 71


tr_hit_id Q0CZ23
Definition tr|Q0CZ23|Q0CZ23_ASPTN Putative uncharacterized protein OS=Aspergillus terreus (strain NIH 2624)
Align length 63
Score (bit) 33.9
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911634|Adiantum capillus-veneris mRNA, clone:
YMU001_000007_D02.
(407 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q0CZ23|Q0CZ23_ASPTN Putative uncharacterized protein OS=Asper... 34 4.2
tr|B6QSG6|B6QSG6_PENMA Arginyl-tRNA synthetase, putative OS=Peni... 33 7.2
tr|B6HSC6|B6HSC6_PENCH Pc22g17020 protein OS=Penicillium chrysog... 33 9.4
tr|A6QYJ9|A6QYJ9_AJECN Predicted protein OS=Ajellomyces capsulat... 33 9.4

>tr|Q0CZ23|Q0CZ23_ASPTN Putative uncharacterized protein
OS=Aspergillus terreus (strain NIH 2624) GN=ATEG_01061
PE=3 SV=1
Length = 824

Score = 33.9 bits (76), Expect = 4.2
Identities = 22/63 (34%), Positives = 30/63 (47%)
Frame = -2

Query: 373 PFEIEVSSKVRSEVTSDSTPRRNRANIVTESSRAEAENSPEGTPPPAQYWEKRMSTTRKK 194
P E E S R V++ TP A +TE R+ ++SP PP Q+ K STT
Sbjct: 142 PLEPEPPSSERWNVSTTPTP----AKPLTERPRSPLKHSPRRRPPLPQFLTKESSTTLFN 197

Query: 193 FET 185
+ T
Sbjct: 198 YST 200


>tr|B6QSG6|B6QSG6_PENMA Arginyl-tRNA synthetase, putative
OS=Penicillium marneffei ATCC 18224 GN=PMAA_001310 PE=4
SV=1
Length = 831

Score = 33.1 bits (74), Expect = 7.2
Identities = 24/73 (32%), Positives = 37/73 (50%)
Frame = -2

Query: 400 SIEGNNLESPFEIEVSSKVRSEVTSDSTPRRNRANIVTESSRAEAENSPEGTPPPAQYWE 221
S+ G++ ES F I +S+ V E++S ++ A VT + E GT P QYW
Sbjct: 467 SLLGHSEESIFSIAISALVAGELSSKRA--QDNAFEVTRMTSFEP-----GTGPYLQYWY 519

Query: 220 KRMSTTRKKFETT 182
R+ T +ET+
Sbjct: 520 ARLCTILDAYETS 532


>tr|B6HSC6|B6HSC6_PENCH Pc22g17020 protein OS=Penicillium
chrysogenum Wisconsin 54-1255 GN=Pc22g17020 PE=4 SV=1
Length = 464

Score = 32.7 bits (73), Expect = 9.4
Identities = 21/70 (30%), Positives = 31/70 (44%)
Frame = -2

Query: 382 LESPFEIEVSSKVRSEVTSDSTPRRNRANIVTESSRAEAENSPEGTPPPAQYWEKRMSTT 203
+E+P E + V + V +D TP++ + TE+ +A A SP P K
Sbjct: 398 IEAPAPTEAPAPVEAPVPTDDTPKKAKKGKKTEAPKAAATESPAAKSPAT----KAKGKV 453

Query: 202 RKKFETT*SK 173
KK T SK
Sbjct: 454 TKKATKTKSK 463


>tr|A6QYJ9|A6QYJ9_AJECN Predicted protein OS=Ajellomyces capsulata
(strain NAm1 / WU24) GN=HCAG_02456 PE=4 SV=1
Length = 955

Score = 32.7 bits (73), Expect = 9.4
Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 2/97 (2%)
Frame = -2

Query: 385 NLESPFEIEVSSKVRSEVTSDSTPRRNRA--NIVTESSRAEAENSPEGTPPPAQYWEKRM 212
NL+ P E+ + K+ + PR I+TE+ R ENSP T P Q +
Sbjct: 623 NLDPP-ELAHALKILLDFARFHQPRSEEELPTIITEAGRPSKENSPHITTPENQ---SKP 678

Query: 211 STTRKKFETT*SKIASSINE*QT*ISWNLRHKDNHTI 101
+TT + +TT + + + +N T ++ + HK I
Sbjct: 679 TTTTPEIDTTITDVITGLNLSLTKLNGHPIHKVTQAI 715