BP911635
Clone id YMU001_000007_D03
Library
Length 534
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000007_D03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATTGTGAAGACACCCAATGGAAACTTGCATGGACAGAGGGATCTACATCTGTCATGCTGT
CAAGAGTAGATTTTCCCTCCTCAAGTAGTCTTTTGCACTCCTTTTGTTCTCCTTGCTCCA
GTTTAAGAGCAGCTATTCTCATATTCAAATACAACACAGGCTCTTCAATTCTTCTCTGCT
GAGATGCACGCAGCTTCTCTATCACTTCAGAAAGATAACTAATTGCAACCTCTACATCAG
TATATTGGCGTGATACAATGACAGCAAAATGTGCAAGCTTCAAGTGGTTGATTTTGCTTT
CAAACTCGGATATAAAATTGCGGTAAAGCTGAATGAGTGCATCACCCCCTTGGAAGACAG
GAAGGCCGACAAATTGTTCAAGCTTGAGAGTCAGCTGATGCCAGAGCTTGCGCTGATAGA
GATCGGCGAGAGAAGTGTACCATTCTGCGAGCTCTGGCTGAGCCTCCCGCTGTGTCTCCA
AATACTGAAGCGCGGCCATGACGAAGCACACACGCAGATCTCTGTCTCCCTCTC
■■Homology search results ■■ -
sp_hit_id P84169
Definition sp|P84169|PSD13_CHICK 26S proteasome non-ATPase regulatory subunit 13 OS=Gallus gallus
Align length 161
Score (bit) 111.0
E-value 2.0e-24
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911635|Adiantum capillus-veneris mRNA, clone:
YMU001_000007_D03.
(534 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P84169|PSD13_CHICK 26S proteasome non-ATPase regulatory subun... 111 2e-24
sp|Q5E964|PSD13_BOVIN 26S proteasome non-ATPase regulatory subun... 109 7e-24
sp|Q9WVJ2|PSD13_MOUSE 26S proteasome non-ATPase regulatory subun... 109 9e-24
sp|Q9UNM6|PSD13_HUMAN 26S proteasome non-ATPase regulatory subun... 107 3e-23
sp|Q54NQ0|PSD13_DICDI 26S proteasome non-ATPase regulatory subun... 91 3e-18
sp|Q9US13|RPN9_SCHPO Probable 26S proteasome regulatory subunit ... 71 3e-12
sp|Q04062|RPN9_YEAST 26S proteasome regulatory subunit RPN9 OS=S... 60 9e-09
sp|Q58718|RAD50_METJA DNA double-strand break repair rad50 ATPas... 33 0.66
sp|A6T226|DNAK_JANMA Chaperone protein dnaK OS=Janthinobacterium... 33 0.86
sp|A7MEV9|MUKB_ENTS8 Chromosome partition protein mukB OS=Entero... 33 1.1
sp|Q63P06|RBSA_BURPS Ribose import ATP-binding protein rbsA OS=B... 32 2.5
sp|Q3JHZ1|RBSA2_BURP1 Ribose import ATP-binding protein rbsA 2 O... 32 2.5
sp|Q822Q4|CLPB_CHLCV Chaperone protein clpB OS=Chlamydophila cav... 31 3.3
sp|Q811U3|RB6I2_RAT ELKS/RAB6-interacting/CAST family member 1 O... 31 4.3
sp|A4G8D2|DNAK_HERAR Chaperone protein dnaK OS=Herminiimonas ars... 31 4.3
sp|Q2T8T6|RBSA2_BURTA Ribose import ATP-binding protein rbsA 2 O... 30 5.6
sp|P48162|R23A1_CAEEL 60S ribosomal protein L23a 1 OS=Caenorhabd... 30 5.6
sp|Q0KIC3|Y1531_DROME Uncharacterized protein CG31531 OS=Drosoph... 30 7.3
sp|Q6MEP4|SYR_PARUW Arginyl-tRNA synthetase OS=Protochlamydia am... 30 7.3
sp|Q8CWW2|SYH_STRMU Histidyl-tRNA synthetase OS=Streptococcus mu... 30 7.3
sp|A8AIF5|MUKB_CITK8 Chromosome partition protein mukB OS=Citrob... 30 7.3
sp|A4FXF3|SYR_METM5 Arginyl-tRNA synthetase OS=Methanococcus mar... 30 9.5
sp|A4VT07|SYH_STRSY Histidyl-tRNA synthetase OS=Streptococcus su... 30 9.5
sp|A4VZ92|SYH_STRS2 Histidyl-tRNA synthetase OS=Streptococcus su... 30 9.5
sp|Q39GY8|RBSA1_BURS3 Ribose import ATP-binding protein rbsA 1 O... 30 9.5
sp|A0K718|RBSA1_BURCH Ribose import ATP-binding protein rbsA 1 O... 30 9.5
sp|Q1BWN5|RBSA1_BURCA Ribose import ATP-binding protein rbsA 1 O... 30 9.5
sp|Q99MI1|RB6I2_MOUSE ELKS/RAB6-interacting/CAST family member 1... 30 9.5
sp|A4W8U3|MUKB_ENT38 Chromosome partition protein mukB OS=Entero... 30 9.5
sp|P40957|MAD1_YEAST Spindle assembly checkpoint component MAD1 ... 30 9.5

>sp|P84169|PSD13_CHICK 26S proteasome non-ATPase regulatory subunit
13 OS=Gallus gallus GN=PSMD13 PE=1 SV=1
Length = 376

Score = 111 bits (277), Expect = 2e-24
Identities = 65/161 (40%), Positives = 97/161 (60%)
Frame = -3

Query: 484 YLETQREAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYRNFISE 305
+L+ + A P A + L +LY +KLWHQLTL++ FV P F GD LI+LY NFISE
Sbjct: 7 FLQQSQSAGPGQAAVWHRLEELYNKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISE 66

Query: 304 FESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNMRIAAL 125
FE ++N L L + V RQ TD VA+++L + EK+++S +E V+ I AL
Sbjct: 67 FEHRVNPLSLVEIILHVVRQMTDPTVALTFLEKTREKVKSS-----DEAVILCKTAIGAL 121

Query: 124 KLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSSQ 2
KL G+ + K +EE + L+++ V SVH+ F+ +SS+
Sbjct: 122 KLNIGDLQVTKETIEEVEEMLNNLPGV-TSVHSRFYDLSSK 161


>sp|Q5E964|PSD13_BOVIN 26S proteasome non-ATPase regulatory subunit
13 OS=Bos taurus GN=PSMD13 PE=2 SV=1
Length = 376

Score = 109 bits (273), Expect = 7e-24
Identities = 64/161 (39%), Positives = 96/161 (59%)
Frame = -3

Query: 484 YLETQREAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYRNFISE 305
+L+ + + P A + L +LY +KLWHQLTL++ FV P F GD LI+LY NFISE
Sbjct: 7 FLQQSQSSGPGQAAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISE 66

Query: 304 FESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNMRIAAL 125
FE ++N L L + V RQ TD VA+S+L + EK+++S +E V+ I AL
Sbjct: 67 FEHRVNPLSLVEIILHVVRQMTDPNVALSFLEKTREKVKSS-----DEAVILCKTAIGAL 121

Query: 124 KLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSSQ 2
KL G+ + K +E+ + L ++ V SVH+ F+ +SS+
Sbjct: 122 KLNIGDLQVTKETIEDVEEMLSNLPGV-TSVHSRFYDLSSK 161


>sp|Q9WVJ2|PSD13_MOUSE 26S proteasome non-ATPase regulatory subunit
13 OS=Mus musculus GN=Psmd13 PE=1 SV=1
Length = 376

Score = 109 bits (272), Expect = 9e-24
Identities = 63/161 (39%), Positives = 97/161 (60%)
Frame = -3

Query: 484 YLETQREAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYRNFISE 305
+L+ + + P A + L +LY +KLWHQLTL++ FV P F GD LI+LY NFISE
Sbjct: 7 FLQQSQSSGPGQAAVWHRLEELYTKKLWHQLTLEVLDFVQDPCFAQGDGLIKLYENFISE 66

Query: 304 FESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNMRIAAL 125
FE ++N L L + V RQ TD VA+++L + EK+++S +E V+ I AL
Sbjct: 67 FEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSS-----DEAVILCKTAIGAL 121

Query: 124 KLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSSQ 2
KL G+ + K +E+ + L+++ V SVH+ F+ +SS+
Sbjct: 122 KLNIGDLQATKETIEDVEEMLNNLPGV-TSVHSRFYDLSSK 161


>sp|Q9UNM6|PSD13_HUMAN 26S proteasome non-ATPase regulatory subunit
13 OS=Homo sapiens GN=PSMD13 PE=1 SV=1
Length = 376

Score = 107 bits (268), Expect = 3e-23
Identities = 66/163 (40%), Positives = 98/163 (60%)
Frame = -3

Query: 490 LQYLETQREAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYRNFI 311
LQ ++ QP A W+ L +LY +KLWHQLTL++ FV P F GD LI+LY NFI
Sbjct: 8 LQQSQSSGPGQP--AVWHR-LEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFI 64

Query: 310 SEFESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNMRIA 131
SEFE ++N L L + V RQ TD VA+++L + EK+++S +E V+ I
Sbjct: 65 SEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSS-----DEAVILCKTAIG 119

Query: 130 ALKLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSSQ 2
ALKL G+ + K +E+ + L+++ V SVH+ F+ +SS+
Sbjct: 120 ALKLNIGDLQVTKETIEDVEEMLNNLPGV-TSVHSRFYDLSSK 161


>sp|Q54NQ0|PSD13_DICDI 26S proteasome non-ATPase regulatory subunit
13 OS=Dictyostelium discoideum GN=psmD13 PE=2 SV=1
Length = 385

Score = 90.9 bits (224), Expect = 3e-18
Identities = 50/162 (30%), Positives = 88/162 (54%)
Frame = -3

Query: 490 LQYLETQREAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYRNFI 311
L+YLE ++ P+L++ ++ D Y+ KLWHQLT ++E + P L Y NFI
Sbjct: 7 LEYLEHLKKIVPDLSDQINNIKDTYENKLWHQLTKQIEMIIISPQLLEKKELFNFYTNFI 66

Query: 310 SEFESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNMRIA 131
+FE+K+ L L + V+RQ+ D + + ++ + +K++ + I NM +
Sbjct: 67 RDFENKLRPLSLVEICIAVARQF-DTDESRKFIETISQKVKKDKSAYILTLSYIANMNLR 125

Query: 130 ALKLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSS 5
+ EQ ++CK+ LE K L +T +D V++SF+ VS+
Sbjct: 126 SGVAEQ--LQDCKKTLELAKEELQGVTGLDTIVYSSFYRVST 165


>sp|Q9US13|RPN9_SCHPO Probable 26S proteasome regulatory subunit
rpn9 OS=Schizosaccharomyces pombe GN=rpn9 PE=2 SV=1
Length = 381

Score = 71.2 bits (173), Expect = 3e-12
Identities = 47/161 (29%), Positives = 83/161 (51%), Gaps = 1/161 (0%)
Frame = -3

Query: 484 YLETQREAQPE-LAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYRNFIS 308
+L Q PE L + Y + DLY+RKLW QLT L F P + + LY NF++
Sbjct: 12 FLHDQATRAPESLQQSYILMEDLYERKLWKQLTDALIVFFDTP--ETVPLRLPLYTNFVN 69

Query: 307 EFESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNMRIAA 128
F IN LK + + ++ E A+ L++++ +L + + ++ +Y + IA
Sbjct: 70 SFRPNINQLKAVYMGLKAFESCSNDE-ALRNLNQIVNEL---DEEKYKDAYVYSIVAIAR 125

Query: 127 LKLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSS 5
+KL G+ E + LL + +D + V+ +H+S++ VS+
Sbjct: 126 IKLISGKLDEARELLVKASKIIDHIDYVESLIHSSYYSVSA 166


>sp|Q04062|RPN9_YEAST 26S proteasome regulatory subunit RPN9
OS=Saccharomyces cerevisiae GN=RPN9 PE=1 SV=1
Length = 393

Score = 59.7 bits (143), Expect = 9e-09
Identities = 41/163 (25%), Positives = 78/163 (47%), Gaps = 8/163 (4%)
Frame = -3

Query: 466 EAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYRNFISEFESKIN 287
EA P L + Y+ KLW QL+ L +F + ++LY NF+S+F KIN
Sbjct: 17 EADPSLHPLFEQFEKFYEEKLWFQLSESLTKF--FDDAKSTPLRLRLYDNFVSKFYDKIN 74

Query: 286 HLKLAHFAVIVSRQYTDVEVAISYLSEV---IEKLRASQQRR-----IEEPVLYLNMRIA 131
L + + + + D + ++ YL ++ ++L + +QR + +L ++ IA
Sbjct: 75 QLSVVKYLLASLKDSKDFDESLKYLDDLKAQFQELDSKKQRNNGSKDHGDGILLIDSEIA 134

Query: 130 ALKLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSSQ 2
L + + + + LL++ + TLD + + SF+ +SQ
Sbjct: 135 RTYLLKNDLVKARDLLDDLEKTLDKKDSIPLRITNSFYSTNSQ 177


>sp|Q58718|RAD50_METJA DNA double-strand break repair rad50 ATPase
OS=Methanocaldococcus jannaschii GN=rad50 PE=3 SV=1
Length = 1005

Score = 33.5 bits (75), Expect = 0.66
Identities = 16/82 (19%), Positives = 39/82 (47%)
Frame = -3

Query: 256 VSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNMRIAALKLEQGEQKECKRLLEE 77
+ R+Y ++ I ++++E + IEE + Y+N ++ + + E K+ K L E
Sbjct: 741 IKRKYNKEDIEIYLNNKILEVNKEIND--IEERISYINQKLDEINYNEEEHKKIKELYEN 798

Query: 76 GKSTLDSMTDVDPSVHASFHWV 11
+ LD++ + + ++
Sbjct: 799 KRQELDNVREQKTEIETGIEYL 820


>sp|A6T226|DNAK_JANMA Chaperone protein dnaK OS=Janthinobacterium
sp. (strain Marseille) GN=dnaK PE=2 SV=1
Length = 650

Score = 33.1 bits (74), Expect = 0.86
Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 12/117 (10%)
Frame = -3

Query: 355 FQGGDALIQLYRNFISEFESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQ 176
F GG+ Q ++I + KIN L L+ A+ + R E A LS +SQQ
Sbjct: 227 FLGGEDFDQRIIDYIIDEFKKINGLDLSKDAIALQRIKASAERAKIELS-------SSQQ 279

Query: 175 RRIEEPVL--------YLNMRIAALKLEQGEQKECKRLLEEGKSTLD----SMTDVD 41
I EP + +LN++I KLE ++ + +E ++ + ++D+D
Sbjct: 280 TEINEPYIAMANGAPVHLNLKITRAKLESLVEELISKTIEPCRTAIKDAGVKVSDID 336


>sp|A7MEV9|MUKB_ENTS8 Chromosome partition protein mukB
OS=Enterobacter sakazakii (strain ATCC BAA-894) GN=mukB
PE=3 SV=1
Length = 1482

Score = 32.7 bits (73), Expect = 1.1
Identities = 17/37 (45%), Positives = 24/37 (64%)
Frame = -3

Query: 187 ASQQRRIEEPVLYLNMRIAALKLEQGEQKECKRLLEE 77
ASQQR + E V L MR++ L+ EQ++ +RLL E
Sbjct: 505 ASQQRHLAEQVQPLRMRLSELEQRLREQQDAERLLAE 541


tr_hit_id A9SX33
Definition tr|A9SX33|A9SX33_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 166
Score (bit) 259.0
E-value 6.0e-68
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911635|Adiantum capillus-veneris mRNA, clone:
YMU001_000007_D03.
(534 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SX33|A9SX33_PHYPA Predicted protein OS=Physcomitrella paten... 259 6e-68
tr|A9SCR8|A9SCR8_PHYPA Predicted protein OS=Physcomitrella paten... 256 4e-67
tr|Q8GYA6|Q8GYA6_ARATH Putative uncharacterized protein At4g1900... 248 1e-64
tr|Q9FK79|Q9FK79_ARATH 26S proteasome subunit-like protein OS=Ar... 246 5e-64
tr|Q8RWF0|Q8RWF0_ARATH 26S proteasome subunit-like protein (26S ... 246 5e-64
tr|Q3E8G4|Q3E8G4_ARATH Uncharacterized protein At5g45620.2 OS=Ar... 246 5e-64
tr|Q94E72|Q94E72_ORYSJ Putative 26S proteasome subunit RPN9b (Pu... 239 5e-62
tr|A2WQL6|A2WQL6_ORYSI Putative uncharacterized protein OS=Oryza... 239 5e-62
tr|B8AQT0|B8AQT0_ORYSI Putative uncharacterized protein OS=Oryza... 236 4e-61
tr|B4FTW8|B4FTW8_MAIZE Putative uncharacterized protein OS=Zea m... 234 2e-60
tr|B4FQ29|B4FQ29_MAIZE 26S proteasome non-ATPase regulatory subu... 234 2e-60
tr|Q10Q05|Q10Q05_ORYSJ Os03g0214600 protein OS=Oryza sativa subs... 234 2e-60
tr|A3AFG6|A3AFG6_ORYSJ Putative uncharacterized protein OS=Oryza... 234 2e-60
tr|B6UAD0|B6UAD0_MAIZE 26S proteasome non-ATPase regulatory subu... 233 5e-60
tr|B6THY8|B6THY8_MAIZE 26S proteasome non-ATPase regulatory subu... 232 8e-60
tr|B6TA88|B6TA88_MAIZE 26S proteasome non-ATPase regulatory subu... 232 8e-60
tr|Q076B1|Q076B1_NICBE RPN9 (Fragment) OS=Nicotiana benthamiana ... 209 5e-53
tr|A7PBY8|A7PBY8_VITVI Chromosome chr2 scaffold_11, whole genome... 187 2e-46
tr|A8IW48|A8IW48_CHLRE 26S proteasome regulatory subunit OS=Chla... 124 2e-27
tr|B5DGU8|B5DGU8_SALSA Proteasome (Prosome, macropain) 26S subun... 118 2e-25
tr|Q7ZU69|Q7ZU69_DANRE Proteasome (Prosome, macropain) 26S subun... 114 2e-24
tr|Q6TGV4|Q6TGV4_DANRE Proteasome 26S subunit, non-ATPase, 13 OS... 114 2e-24
tr|B5DGU7|B5DGU7_SALSA Proteasome (Prosome, macropain) 26S subun... 114 2e-24
tr|A8WGP1|A8WGP1_DANRE Proteasome (Prosome, macropain) 26S subun... 114 3e-24
tr|B2RT97|B2RT97_MOUSE Proteasome (Prosome, macropain) 26S subun... 109 1e-22
tr|B0BN93|B0BN93_RAT Proteasome (Prosome, macropain) 26S subunit... 109 1e-22
tr|Q9Y6E3|Q9Y6E3_HUMAN HSPC027 OS=Homo sapiens PE=2 SV=1 108 2e-22
tr|Q66IX2|Q66IX2_XENLA MGC84231 protein OS=Xenopus laevis GN=psm... 107 3e-22
tr|Q53XU2|Q53XU2_HUMAN Proteasome (Prosome, macropain) 26S subun... 107 3e-22
tr|Q6GLI4|Q6GLI4_XENTR Proteasome (Prosome, macropain) 26S subun... 107 4e-22

>tr|A9SX33|A9SX33_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_189316 PE=4 SV=1
Length = 386

Score = 259 bits (662), Expect = 6e-68
Identities = 125/166 (75%), Positives = 146/166 (87%)
Frame = -3

Query: 499 MAALQYLETQREAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYR 320
MAALQYLE QR AQPELAEWYTS+ADLYQRKLWHQLT KL+QFV L VFQ GD L+QLY
Sbjct: 1 MAALQYLEKQRAAQPELAEWYTSMADLYQRKLWHQLTQKLDQFVALTVFQAGDTLVQLYH 60

Query: 319 NFISEFESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNM 140
NFI +FE+KIN LKLAHFAVIVS+QY + + AI+YL EVIEKLR S +RR+EEP+LY+ M
Sbjct: 61 NFIRDFETKINLLKLAHFAVIVSKQYPEKDAAIAYLEEVIEKLRTSGERRVEEPILYVKM 120

Query: 139 RIAALKLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSSQ 2
++AA+KL++GE + CK+LLEEGK+TLDSMTDVDPSVHAS HWVSSQ
Sbjct: 121 QVAAMKLQRGEIQVCKKLLEEGKTTLDSMTDVDPSVHASVHWVSSQ 166


>tr|A9SCR8|A9SCR8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_210905 PE=4 SV=1
Length = 386

Score = 256 bits (655), Expect = 4e-67
Identities = 123/166 (74%), Positives = 145/166 (87%)
Frame = -3

Query: 499 MAALQYLETQREAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYR 320
MAALQYLE QR AQPELAEWY S+ADLYQRKLWHQLT KL+QFV L VFQ GD L+QLY
Sbjct: 1 MAALQYLEKQRAAQPELAEWYASMADLYQRKLWHQLTQKLDQFVALTVFQAGDTLVQLYH 60

Query: 319 NFISEFESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNM 140
NFI +FE+KIN LKLAHFAVIVS+QY + A++YL EVIEKLR S +RR++EP+LY+ M
Sbjct: 61 NFIRDFETKINLLKLAHFAVIVSKQYPEKGAAVAYLEEVIEKLRTSGERRVDEPILYVKM 120

Query: 139 RIAALKLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSSQ 2
++AALKL++GE +ECK+LLEEG++TLDSMTDVDPSVHAS HWVSSQ
Sbjct: 121 QVAALKLQRGEIQECKKLLEEGRTTLDSMTDVDPSVHASVHWVSSQ 166


>tr|Q8GYA6|Q8GYA6_ARATH Putative uncharacterized protein At4g19006
(26S proteasome subunit RPN9b) OS=Arabidopsis thaliana
GN=RPN9b PE=2 SV=1
Length = 386

Score = 248 bits (633), Expect = 1e-64
Identities = 117/166 (70%), Positives = 143/166 (86%)
Frame = -3

Query: 499 MAALQYLETQREAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYR 320
MAALQYLE+Q+ A PEL EWY SLADLYQ+KLWHQLTLKLEQF+ L VFQ GDALIQLY
Sbjct: 1 MAALQYLESQKNAHPELGEWYNSLADLYQKKLWHQLTLKLEQFIALSVFQAGDALIQLYN 60

Query: 319 NFISEFESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNM 140
NFI++FE++IN LKLAHFAV+VSRQY + E A+SYL VIEKL+A+++ RI EP+ Y+
Sbjct: 61 NFITDFETRINLLKLAHFAVVVSRQYPEKEAAVSYLEGVIEKLKATKESRINEPISYIET 120

Query: 139 RIAALKLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSSQ 2
+IA KLEQG+QKECK++L++GKS LDSMTD+DPSV+A+F WVSSQ
Sbjct: 121 QIALFKLEQGDQKECKKILDDGKSLLDSMTDIDPSVYANFFWVSSQ 166


>tr|Q9FK79|Q9FK79_ARATH 26S proteasome subunit-like protein
OS=Arabidopsis thaliana PE=4 SV=1
Length = 375

Score = 246 bits (628), Expect = 5e-64
Identities = 115/166 (69%), Positives = 143/166 (86%)
Frame = -3

Query: 499 MAALQYLETQREAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYR 320
MAALQYLE+ + PEL EWY SLADLYQ+KLWHQLTLKLEQF+ L VFQ GDALIQ Y
Sbjct: 1 MAALQYLESLKNTHPELGEWYNSLADLYQKKLWHQLTLKLEQFIALAVFQAGDALIQFYH 60

Query: 319 NFISEFESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNM 140
NFI++FE+KIN LKLAHFAV+VSRQY++ E A+SYL VIEKLRA+++ RI EP++Y+
Sbjct: 61 NFITDFETKINLLKLAHFAVVVSRQYSEKEAAVSYLESVIEKLRATKEPRITEPIIYIET 120

Query: 139 RIAALKLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSSQ 2
+ A KLEQG+QKECK++L++GKS+LDSMTD+DPSV+A+F+WVSSQ
Sbjct: 121 QKALFKLEQGDQKECKKILDDGKSSLDSMTDIDPSVYANFYWVSSQ 166


>tr|Q8RWF0|Q8RWF0_ARATH 26S proteasome subunit-like protein (26S
proteasome subunit RPN9a) OS=Arabidopsis thaliana
GN=RPN9a PE=2 SV=1
Length = 386

Score = 246 bits (628), Expect = 5e-64
Identities = 115/166 (69%), Positives = 143/166 (86%)
Frame = -3

Query: 499 MAALQYLETQREAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYR 320
MAALQYLE+ + PEL EWY SLADLYQ+KLWHQLTLKLEQF+ L VFQ GDALIQ Y
Sbjct: 1 MAALQYLESLKNTHPELGEWYNSLADLYQKKLWHQLTLKLEQFIALAVFQAGDALIQFYH 60

Query: 319 NFISEFESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNM 140
NFI++FE+KIN LKLAHFAV+VSRQY++ E A+SYL VIEKLRA+++ RI EP++Y+
Sbjct: 61 NFITDFETKINLLKLAHFAVVVSRQYSEKEAAVSYLESVIEKLRATKEPRITEPIIYIET 120

Query: 139 RIAALKLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSSQ 2
+ A KLEQG+QKECK++L++GKS+LDSMTD+DPSV+A+F+WVSSQ
Sbjct: 121 QKALFKLEQGDQKECKKILDDGKSSLDSMTDIDPSVYANFYWVSSQ 166


>tr|Q3E8G4|Q3E8G4_ARATH Uncharacterized protein At5g45620.2
OS=Arabidopsis thaliana GN=At5g45620 PE=4 SV=1
Length = 350

Score = 246 bits (628), Expect = 5e-64
Identities = 115/166 (69%), Positives = 143/166 (86%)
Frame = -3

Query: 499 MAALQYLETQREAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYR 320
MAALQYLE+ + PEL EWY SLADLYQ+KLWHQLTLKLEQF+ L VFQ GDALIQ Y
Sbjct: 1 MAALQYLESLKNTHPELGEWYNSLADLYQKKLWHQLTLKLEQFIALAVFQAGDALIQFYH 60

Query: 319 NFISEFESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNM 140
NFI++FE+KIN LKLAHFAV+VSRQY++ E A+SYL VIEKLRA+++ RI EP++Y+
Sbjct: 61 NFITDFETKINLLKLAHFAVVVSRQYSEKEAAVSYLESVIEKLRATKEPRITEPIIYIET 120

Query: 139 RIAALKLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSSQ 2
+ A KLEQG+QKECK++L++GKS+LDSMTD+DPSV+A+F+WVSSQ
Sbjct: 121 QKALFKLEQGDQKECKKILDDGKSSLDSMTDIDPSVYANFYWVSSQ 166


>tr|Q94E72|Q94E72_ORYSJ Putative 26S proteasome subunit RPN9b
(Putative uncharacterized protein) (Os01g0511300
protein) OS=Oryza sativa subsp. japonica
GN=OSJNBa0054L14.8 PE=4 SV=1
Length = 385

Score = 239 bits (611), Expect = 5e-62
Identities = 115/164 (70%), Positives = 141/164 (85%)
Frame = -3

Query: 493 ALQYLETQREAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYRNF 314
ALQY+E QR+A+P+LA+ Y LADLYQRKLWHQLTLKL+ F+ LP Q GD +IQLY NF
Sbjct: 2 ALQYVEAQRQARPDLADAYADLADLYQRKLWHQLTLKLDHFLQLPAAQTGDTIIQLYNNF 61

Query: 313 ISEFESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNMRI 134
IS+FE+KIN LKLAHFAVI SRQY D + AIS+L V KLR +++RRI+EPVLY+ M+I
Sbjct: 62 ISDFETKINLLKLAHFAVIASRQYPDKDAAISFLEGVTAKLRETRERRIDEPVLYVKMQI 121

Query: 133 AALKLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSSQ 2
AA+ LE+G+QKECK+LL+EGKSTLDSMTDVDP+VHASF+W+SSQ
Sbjct: 122 AAINLEKGDQKECKKLLDEGKSTLDSMTDVDPTVHASFYWISSQ 165


>tr|A2WQL6|A2WQL6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_02152 PE=4 SV=1
Length = 385

Score = 239 bits (611), Expect = 5e-62
Identities = 115/164 (70%), Positives = 141/164 (85%)
Frame = -3

Query: 493 ALQYLETQREAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYRNF 314
ALQY+E QR+A+P+LA+ Y LADLYQRKLWHQLTLKL+ F+ LP Q GD +IQLY NF
Sbjct: 2 ALQYVEAQRQARPDLADAYADLADLYQRKLWHQLTLKLDHFLQLPAAQTGDTIIQLYNNF 61

Query: 313 ISEFESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNMRI 134
IS+FE+KIN LKLAHFAVI SRQY D + AIS+L V KLR +++RRI+EPVLY+ M+I
Sbjct: 62 ISDFETKINLLKLAHFAVIASRQYPDKDAAISFLEGVTAKLRETRERRIDEPVLYVKMQI 121

Query: 133 AALKLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSSQ 2
AA+ LE+G+QKECK+LL+EGKSTLDSMTDVDP+VHASF+W+SSQ
Sbjct: 122 AAINLEKGDQKECKKLLDEGKSTLDSMTDVDPTVHASFYWISSQ 165


>tr|B8AQT0|B8AQT0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10521 PE=4 SV=1
Length = 385

Score = 236 bits (603), Expect = 4e-61
Identities = 115/164 (70%), Positives = 139/164 (84%)
Frame = -3

Query: 493 ALQYLETQREAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYRNF 314
ALQ++E+QREA+PELA+ Y LADLYQRKLWHQLTLKL+ F+ LP Q GD LIQLY NF
Sbjct: 2 ALQFVESQREARPELADPYADLADLYQRKLWHQLTLKLDHFLQLPAAQTGDTLIQLYNNF 61

Query: 313 ISEFESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNMRI 134
I++FE+KIN LKLAHFAVI SRQY D + AIS+L VI KLR ++ RI EP+LY+ M+I
Sbjct: 62 ITDFETKINLLKLAHFAVIASRQYPDKDAAISFLEGVITKLRETKDLRINEPILYVKMQI 121

Query: 133 AALKLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSSQ 2
AA+ LE+G QKECK+LL+EGKSTLDSMTDVDP+VHASF+W+SSQ
Sbjct: 122 AAINLEKGNQKECKKLLDEGKSTLDSMTDVDPTVHASFYWISSQ 165


>tr|B4FTW8|B4FTW8_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 385

Score = 234 bits (598), Expect = 2e-60
Identities = 111/164 (67%), Positives = 139/164 (84%)
Frame = -3

Query: 493 ALQYLETQREAQPELAEWYTSLADLYQRKLWHQLTLKLEQFVGLPVFQGGDALIQLYRNF 314
ALQY+E QR+A+P+LA+WY SLADLYQ+KLWHQLTLKL+QF+ L Q GD +IQLY NF
Sbjct: 2 ALQYVEAQRQARPDLADWYASLADLYQQKLWHQLTLKLDQFLQLQAAQTGDTIIQLYNNF 61

Query: 313 ISEFESKINHLKLAHFAVIVSRQYTDVEVAISYLSEVIEKLRASQQRRIEEPVLYLNMRI 134
I++FE+KIN LKLAHFAVI SRQY D + AI++L VI KLR +++ RI EP+LY+ M+I
Sbjct: 62 ITDFETKINLLKLAHFAVIASRQYPDKDAAITFLEGVITKLRDTRESRINEPILYVKMQI 121

Query: 133 AALKLEQGEQKECKRLLEEGKSTLDSMTDVDPSVHASFHWVSSQ 2
AA+ LE+G QKECK LE+GK+TLDSMTDVDP+VHASF+W+SSQ
Sbjct: 122 AAINLEKGNQKECKNSLEDGKTTLDSMTDVDPTVHASFYWISSQ 165