BP911659
Clone id YMU001_000007_F07
Library
Length 376
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000007_F07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CCCATAAGGGGAGTCCCACTACAAATATTTACAGAGCCATAGTGACTTATTGAAATGAGA
TTCTAAGATACTGTGCAACTATAAAATGGCCAAGAATAATTGCCGTCGCCTCTTCATCAG
CTCCCCGCATTCCACTCTACAAAATCATCATCAACTCAATTAGTAAAATAAATAGACAGC
ACATAATTAACCATTACGCCCAGCTATCCCAATTGCAGTTAACCACTACACCAGGAGGGT
GCCCAGTCTCGTAACAATGTGCATGTATTGTCAAACATAAGTCAAAAGGAAGAGGGGAAA
AGTTGGTTCAAGATTAGCCGAGGAAGGAAGAGAACATGTGTTAGCATATGCACGAGTTGC
ATTCTTTAATTGTTCA
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911659|Adiantum capillus-veneris mRNA, clone:
YMU001_000007_F07.
(376 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id Q01H72
Definition tr|Q01H72|Q01H72_OSTTA PAB-dependent poly(A) ribonuclease, subunit PAN2 (ISS) OS=Ostreococcus tauri
Align length 28
Score (bit) 32.7
E-value 9.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911659|Adiantum capillus-veneris mRNA, clone:
YMU001_000007_F07.
(376 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q01H72|Q01H72_OSTTA PAB-dependent poly(A) ribonuclease, subun... 33 9.2
tr|A5DRF6|A5DRF6_PICGU Putative uncharacterized protein OS=Pichi... 33 9.2

>tr|Q01H72|Q01H72_OSTTA PAB-dependent poly(A) ribonuclease, subunit
PAN2 (ISS) OS=Ostreococcus tauri GN=Ot01g00110 PE=4 SV=1
Length = 1189

Score = 32.7 bits (73), Expect = 9.2
Identities = 11/28 (39%), Positives = 15/28 (53%)
Frame = -1

Query: 289 PFDLCLTIHAHCYETGHPPGVVVNCNWD 206
PFD C T+ E GH P + +C +D
Sbjct: 34 PFDACTTLQTELLEEGHAPPAITSCGFD 61


>tr|A5DRF6|A5DRF6_PICGU Putative uncharacterized protein OS=Pichia
guilliermondii GN=PGUG_05857 PE=4 SV=2
Length = 298

Score = 32.7 bits (73), Expect = 9.2
Identities = 19/61 (31%), Positives = 30/61 (49%)
Frame = -2

Query: 375 EQLKNATRAYANTCSLPSSANLEPTFPLFLLTYV*QYMHIVTRLGTLLV*WLTAIGIAGR 196
E++K+ RA +L + N+ ++PL+L T V + I L T L WL +I
Sbjct: 67 ERMKSVKRASYKNLNLETIKNIVSSWPLYLFTAVVVFHEISINLSTFLNLWLKSISRYSH 126

Query: 195 N 193
N
Sbjct: 127 N 127