BP911669
Clone id YMU001_000007_G07
Library
Length 398
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000007_G07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATATTACCTGCAGGTACTCGGAAGAATTCGCGGCCTCGCAACTGACACTCCAGCTCTTCA
CACTTCACCGCTGCTAACCCATGAACCTTCTTCTCCTCGGCCAGCTCCAATGTTAGCGAT
GCAATACTGGTTTGCAACTTGTTTACTTCTCCTTCAGCTTCCCGCAACTTACCCTGTAGC
TCAACCTTGATGGCTTCTACTTCAGACAAATTTTTCTCTATGGCATGCAAGCCTGCTACC
TTGCTTTGAAGATTGATGACAAGATCTTTGCTTTCACCAAGTTCAATCTTTGTCCCTCCC
AATTCCTCTGAGATAGAGGCGATTTGCAACTCCAATTCGGCCTAGGCATCACCCATTTGC
TGGAGCTGATCTCGAACTAAAGCGATCTCACTCATAAA
■■Homology search results ■■ -
sp_hit_id O67124
Definition sp|O67124|RAD50_AQUAE Probable DNA double-strand break repair rad50 ATPase OS=Aquifex aeolicus
Align length 128
Score (bit) 43.1
E-value 0.0004
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911669|Adiantum capillus-veneris mRNA, clone:
YMU001_000007_G07.
(398 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O67124|RAD50_AQUAE Probable DNA double-strand break repair ra... 43 4e-04
sp|Q8LLE5|FPP_SOLLC Filament-like plant protein (Fragment) OS=So... 42 7e-04
sp|Q86RN8|MYSP_BOOMI Paramyosin OS=Boophilus microplus GN=PRM PE... 42 0.001
sp|Q0WSY2|FPP4_ARATH Filament-like plant protein 4 OS=Arabidopsi... 42 0.001
sp|Q90339|MYSS_CYPCA Myosin heavy chain, fast skeletal muscle OS... 40 0.003
sp|Q258K2|MYH9_CANFA Myosin-9 OS=Canis familiaris GN=MYH9 PE=2 SV=1 40 0.003
sp|P39922|MYS3_HYDAT Myosin heavy chain, clone 203 (Fragment) OS... 40 0.004
sp|Q9WVQ0|PMFBP_MOUSE Polyamine-modulated factor 1-binding prote... 40 0.005
sp|P35579|MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 39 0.006
sp|P13540|MYH7_MESAU Myosin-7 OS=Mesocricetus auratus GN=MYH7 PE... 39 0.006
sp|Q8TC92|ENOX1_HUMAN Ecto-NOX disulfide-thiol exchanger 1 OS=Ho... 39 0.006
sp|P12845|MYO2_CAEEL Myosin-2 OS=Caenorhabditis elegans GN=myo-2... 39 0.008
sp|Q62812|MYH9_RAT Myosin-9 OS=Rattus norvegicus GN=Myh9 PE=1 SV=3 39 0.008
sp|Q8VDD5|MYH9_MOUSE Myosin-9 OS=Mus musculus GN=Myh9 PE=1 SV=4 39 0.008
sp|P02564|MYH7_RAT Myosin-7 OS=Rattus norvegicus GN=Myh7 PE=2 SV=2 39 0.008
sp|Q91Z83|MYH7_MOUSE Myosin-7 OS=Mus musculus GN=Myh7 PE=1 SV=1 39 0.008
sp|Q9C698|FPP6_ARATH Filament-like plant protein 6 OS=Arabidopsi... 39 0.008
sp|P12883|MYH7_HUMAN Myosin-7 OS=Homo sapiens GN=MYH7 PE=1 SV=5 39 0.010
sp|Q8MJU9|MYH7_HORSE Myosin-7 OS=Equus caballus GN=MYH7 PE=2 SV=1 39 0.010
sp|P49824|MYH7_CANFA Myosin-7 OS=Canis familiaris GN=MYH7 PE=1 SV=3 39 0.010
sp|Q9BE39|MYH7_BOVIN Myosin-7 OS=Bos taurus GN=MYH7 PE=2 SV=1 39 0.010
sp|P12847|MYH3_RAT Myosin-3 OS=Rattus norvegicus GN=Myh3 PE=2 SV=1 39 0.010
sp|P13541|MYH3_MOUSE Myosin-3 OS=Mus musculus GN=Myh3 PE=2 SV=2 39 0.010
sp|P02545|LMNA_HUMAN Lamin-A/C OS=Homo sapiens GN=LMNA PE=1 SV=1 39 0.010
sp|Q8BHR2|ENOX1_MOUSE Ecto-NOX disulfide-thiol exchanger 1 OS=Mu... 39 0.010
sp|P02562|MYSS_RABIT Myosin heavy chain, skeletal muscle (Fragme... 38 0.014
sp|Q8TXI4|RAD50_METKA DNA double-strand break repair rad50 ATPas... 38 0.018
sp|P79293|MYH7_PIG Myosin-7 OS=Sus scrofa GN=MYH7 PE=2 SV=2 38 0.018
sp|P11055|MYH3_HUMAN Myosin-3 OS=Homo sapiens GN=MYH3 PE=1 SV=2 38 0.018
sp|P48679|LMNA_RAT Lamin-A OS=Rattus norvegicus GN=Lmna PE=1 SV=1 38 0.018

>sp|O67124|RAD50_AQUAE Probable DNA double-strand break repair rad50
ATPase OS=Aquifex aeolicus GN=rad50 PE=3 SV=1
Length = 978

Score = 43.1 bits (100), Expect = 4e-04
Identities = 34/128 (26%), Positives = 61/128 (47%), Gaps = 5/128 (3%)
Frame = -1

Query: 395 MSEIALVRDQLQQMGDA*AELELQIASISEELGGTKIELGESKDLVINLQSKVAGLHAIE 216
+ EI + +L Q+ + E E + +E + + K LV + K+ + +
Sbjct: 345 LQEIKEILKELSQLSSSLKEKEREYEQAKQEFEDLSERVEKGKKLVAETEEKLEKIKELF 404

Query: 215 K-----NLSEVEAIKVELQGKLREAEGEVNKLQTSIASLTLELAEEKKVHGLAAVKCEEL 51
+L E + VELQ KL+E + + +L+ +LT + E+KKVH + +EL
Sbjct: 405 SEEEYTSLKMKERLLVELQRKLKELKEKEGQLE----NLTQKYKEKKKVHEKVLNELKEL 460

Query: 50 ECQLRGRE 27
E +L+ RE
Sbjct: 461 ERELKERE 468


>sp|Q8LLE5|FPP_SOLLC Filament-like plant protein (Fragment)
OS=Solanum lycopersicum GN=FPP PE=1 SV=1
Length = 582

Score = 42.4 bits (98), Expect = 7e-04
Identities = 31/105 (29%), Positives = 47/105 (44%), Gaps = 4/105 (3%)
Frame = -1

Query: 338 ELELQIASISEELGGTKIELGESKDLV----INLQSKVAGLHAIEKNLSEVEAIKVELQG 171
ELE ++ I E + ES+D + + L+ L ++K L V K L+
Sbjct: 323 ELEQKLEKIEAEKAELENAFNESQDALKVSSLQLKETQTRLEGLQKELDVVNESKELLEF 382

Query: 170 KLREAEGEVNKLQTSIASLTLELAEEKKVHGLAAVKCEELECQLR 36
+L E E + +I SL E+ +EK + KC ELE LR
Sbjct: 383 QLYGMEVEARTMSVNIDSLKTEVEKEKSLSSEMEAKCHELENDLR 427


>sp|Q86RN8|MYSP_BOOMI Paramyosin OS=Boophilus microplus GN=PRM PE=1
SV=1
Length = 873

Score = 42.0 bits (97), Expect = 0.001
Identities = 27/91 (29%), Positives = 48/91 (52%), Gaps = 5/91 (5%)
Frame = -1

Query: 338 ELELQIASISEELGGTKIELGESKDLVINLQSKVAGLHAIEKNLS-EVEAIKVELQ---- 174
EL ++ + E T +EL +KD+++ Q + + +I+K+L EV ++V L+
Sbjct: 666 ELHKELRVVDERCQRTIVELKSTKDILVEEQERYIKVESIKKSLEVEVRNLQVRLEEVEA 725

Query: 173 GKLREAEGEVNKLQTSIASLTLELAEEKKVH 81
L + + KL+ I + +EL EEKK H
Sbjct: 726 NALAGGKRVIAKLEARIRDVEIELEEEKKRH 756


>sp|Q0WSY2|FPP4_ARATH Filament-like plant protein 4 OS=Arabidopsis
thaliana GN=FPP4 PE=2 SV=1
Length = 982

Score = 42.0 bits (97), Expect = 0.001
Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 4/103 (3%)
Frame = -1

Query: 332 ELQIASISEELGGTKIELGESKDLVINLQSKVAGLHAI----EKNLSEVEAIKVELQGKL 165
E +AS +L TK +L E++ L+ ++S + E L + L+ +
Sbjct: 742 ESNLASCEADLEATKTKLQETEKLLAEVKSDLESAQKSNGMGETQLKCMVESYRSLETRS 801

Query: 164 REAEGEVNKLQTSIASLTLELAEEKKVHGLAAVKCEELECQLR 36
E E E+ L+ I +L EL +EK+ H A KC+ELE QL+
Sbjct: 802 SELEIELTSLKGKIENLEDELHDEKENHREALAKCQELEEQLQ 844


>sp|Q90339|MYSS_CYPCA Myosin heavy chain, fast skeletal muscle
OS=Cyprinus carpio PE=2 SV=2
Length = 1935

Score = 40.4 bits (93), Expect = 0.003
Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 1/109 (0%)
Frame = -1

Query: 371 DQLQQMGDA*AELELQIASISEELGGTKIELGESKDLVINLQSKVAGLHAIEKNLSEVEA 192
D L+ + L+ +I+ ++E+LG E G+S +H +EK VE+
Sbjct: 1494 DHLETLKRENKNLQQEISDLTEQLG----ETGKS-------------IHELEKAKKTVES 1536

Query: 191 IKVELQGKLREAEGEVNKLQTSIASLTLELAEEK-KVHGLAAVKCEELE 48
K E+Q L EAEG + ++ I + LEL + K ++ A K EE+E
Sbjct: 1537 EKSEIQTALEEAEGTLEHEESKILRVQLELNQVKSEIDRKLAEKDEEME 1585


>sp|Q258K2|MYH9_CANFA Myosin-9 OS=Canis familiaris GN=MYH9 PE=2 SV=1
Length = 1960

Score = 40.4 bits (93), Expect = 0.003
Identities = 31/125 (24%), Positives = 61/125 (48%), Gaps = 1/125 (0%)
Frame = -1

Query: 398 FMSEIALVRDQLQQMGDA*AELELQIASISEELGGTKIELGESKDLVINLQSKVAGLHAI 219
F +E+ + +G + ELE ++ +++ K +L E +D LQ+ +
Sbjct: 1502 FRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELED---ELQATEDAKLRL 1558

Query: 218 EKNLSEVEA-IKVELQGKLREAEGEVNKLQTSIASLTLELAEEKKVHGLAAVKCEELECQ 42
E NL ++A + +LQG+ ++E + +L + + EL +EKK +A ++LE
Sbjct: 1559 EVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDEKKQRSMAVAARKKLEMD 1618

Query: 41 LRGRE 27
L+ E
Sbjct: 1619 LKDLE 1623



Score = 29.6 bits (65), Expect = 4.9
Identities = 22/93 (23%), Positives = 44/93 (47%)
Frame = -1

Query: 392 SEIALVRDQLQQMGDA*AELELQIASISEELGGTKIELGESKDLVINLQSKVAGLHAIEK 213
S++ ++ LQ+ L ++ + +E K +L E ++ NL+ ++A LHA
Sbjct: 1308 SQLQDTQELLQEENRQKLSLSTKLKQMEDEKNSFKEQLEEEEEAKRNLEKQIATLHA--- 1364

Query: 212 NLSEVEAIKVELQGKLREAEGEVNKLQTSIASL 114
+++++ + G L AE KLQ + L
Sbjct: 1365 QVTDMKKKMEDGVGCLETAEEAKRKLQKDLEGL 1397



Score = 29.3 bits (64), Expect = 6.4
Identities = 30/124 (24%), Positives = 51/124 (41%), Gaps = 25/124 (20%)
Frame = -1

Query: 377 VRDQLQQMGDA*AELELQIASISEELGGTKIELGES------------------KDLVIN 252
+ DQ+ ++ AEL++Q+A EEL + E +L +
Sbjct: 1060 LNDQIAELQAQIAELKMQLAKKEEELQAALARVEEEATQKNMALKKIRELESQISELQED 1119

Query: 251 LQSKVAGLHAIEKNL----SEVEAIKVELQGKLREAEGEV---NKLQTSIASLTLELAEE 93
L+S+ A + EK E+EA+K EL+ L + +K + + L L EE
Sbjct: 1120 LESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEE 1179

Query: 92 KKVH 81
+ H
Sbjct: 1180 ARTH 1183


>sp|P39922|MYS3_HYDAT Myosin heavy chain, clone 203 (Fragment)
OS=Hydra attenuata PE=2 SV=1
Length = 539

Score = 40.0 bits (92), Expect = 0.004
Identities = 27/118 (22%), Positives = 60/118 (50%)
Frame = -1

Query: 392 SEIALVRDQLQQMGDA*AELELQIASISEELGGTKIELGESKDLVINLQSKVAGLHAIEK 213
S I + L++ D+ +LE + + +L + +L E++ + Q V EK
Sbjct: 232 SSIREIEQDLKKEKDSKMKLEKEKKKVESDLKDNRDKLSETETRLKETQDLVTKR---EK 288

Query: 212 NLSEVEAIKVELQGKLREAEGEVNKLQTSIASLTLELAEEKKVHGLAAVKCEELECQL 39
++S++E K L+ ++ + + ++ +L I L EL E+K+ + ++ +ELE ++
Sbjct: 289 SISDLENAKEGLESQISQLQRKIQELLAKIEELEEELENERKLRQKSELQRKELESRI 346


>sp|Q9WVQ0|PMFBP_MOUSE Polyamine-modulated factor 1-binding protein
1 OS=Mus musculus GN=Pmfbp1 PE=2 SV=1
Length = 1022

Score = 39.7 bits (91), Expect = 0.005
Identities = 25/72 (34%), Positives = 36/72 (50%)
Frame = -1

Query: 251 LQSKVAGLHAIEKNLSEVEAIKVELQGKLREAEGEVNKLQTSIASLTLELAEEKKVHGLA 72
LQ K LH +EKNL +V Q LRE E E+ KLQ + L L E ++ +
Sbjct: 417 LQDKDERLHELEKNLMQV-------QNSLREKEAELEKLQCTTKELDTSLQEARQ--STS 467

Query: 71 AVKCEELECQLR 36
+ CE L +++
Sbjct: 468 KIDCEALRAEIQ 479


>sp|P35579|MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4
Length = 1960

Score = 39.3 bits (90), Expect = 0.006
Identities = 30/125 (24%), Positives = 61/125 (48%), Gaps = 1/125 (0%)
Frame = -1

Query: 398 FMSEIALVRDQLQQMGDA*AELELQIASISEELGGTKIELGESKDLVINLQSKVAGLHAI 219
F +E+ + +G + ELE ++ +++ K +L E +D LQ+ +
Sbjct: 1502 FRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELED---ELQATEDAKLRL 1558

Query: 218 EKNLSEVEA-IKVELQGKLREAEGEVNKLQTSIASLTLELAEEKKVHGLAAVKCEELECQ 42
E NL ++A + +LQG+ ++E + +L + + EL +E+K +A ++LE
Sbjct: 1559 EVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMD 1618

Query: 41 LRGRE 27
L+ E
Sbjct: 1619 LKDLE 1623



Score = 30.4 bits (67), Expect = 2.9
Identities = 24/101 (23%), Positives = 49/101 (48%)
Frame = -1

Query: 392 SEIALVRDQLQQMGDA*AELELQIASISEELGGTKIELGESKDLVINLQSKVAGLHAIEK 213
S++ ++ LQ+ L ++ + +E + +L E ++ NL+ ++A LHA
Sbjct: 1308 SQLQDTQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHA--- 1364

Query: 212 NLSEVEAIKVELQGKLREAEGEVNKLQTSIASLTLELAEEK 90
+++++ + G L AE KLQ + L+ + EEK
Sbjct: 1365 QVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLS-QRHEEK 1404



Score = 30.4 bits (67), Expect = 2.9
Identities = 31/134 (23%), Positives = 62/134 (46%), Gaps = 18/134 (13%)
Frame = -1

Query: 374 RDQLQQMGDA*AELELQIASISEELGGTKIELGES-------KDLVINLQSKVAGLHAIE 216
R+QL++ +A LE QIA++ ++ K ++ +S +++ LQ + GL
Sbjct: 1342 REQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQRH 1401

Query: 215 KN----LSEVEAIKVELQGKLREAEGEVNKLQTSIASLTLE-------LAEEKKVHGLAA 69
+ ++E K LQ +L + +++ + S +L + LAEEK + A
Sbjct: 1402 EEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQLLAEEKTISAKYA 1461

Query: 68 VKCEELECQLRGRE 27
+ + E + R +E
Sbjct: 1462 EERDRAEAEAREKE 1475



Score = 30.0 bits (66), Expect = 3.7
Identities = 31/122 (25%), Positives = 50/122 (40%), Gaps = 25/122 (20%)
Frame = -1

Query: 371 DQLQQMGDA*AELELQIASISEELGGTKIELGES------------------KDLVINLQ 246
DQ+ ++ AEL++Q+A EEL + E +L +L+
Sbjct: 1062 DQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLE 1121

Query: 245 SKVAGLHAIEKNL----SEVEAIKVELQGKLREAEGEV---NKLQTSIASLTLELAEEKK 87
S+ A + EK E+EA+K EL+ L + +K + + L L EE K
Sbjct: 1122 SERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAK 1181

Query: 86 VH 81
H
Sbjct: 1182 TH 1183


>sp|P13540|MYH7_MESAU Myosin-7 OS=Mesocricetus auratus GN=MYH7 PE=2
SV=2
Length = 1934

Score = 39.3 bits (90), Expect = 0.006
Identities = 27/77 (35%), Positives = 39/77 (50%), Gaps = 1/77 (1%)
Frame = -1

Query: 275 ESKDLVINLQSKVAGLHAIEKNLSEVEAIKVELQGKLREAEGEVNKLQTSIASLTLELAE 96
E DL L S +H +EK ++EA K+ELQ L EAE + + +I LE +
Sbjct: 1507 EISDLTEQLGSTGKSIHELEKIRKQLEAEKMELQSALEEAEASLEHEEGNILRAQLEFNQ 1566

Query: 95 EK-KVHGLAAVKCEELE 48
K ++ A K EE+E
Sbjct: 1567 IKAEIERKLAEKDEEME 1583



Score = 36.6 bits (83), Expect = 0.040
Identities = 31/130 (23%), Positives = 58/130 (44%), Gaps = 11/130 (8%)
Frame = -1

Query: 389 EIALVRDQLQQMGDA*AELELQIASISEELGGTKIELGESKD-----------LVINLQS 243
E V+D L++ ELE ++ S+ +E ++++ +D L+ N
Sbjct: 854 EFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQ 913

Query: 242 KVAGLHAIEKNLSEVEAIKVELQGKLREAEGEVNKLQTSIASLTLELAEEKKVHGLAAVK 63
A + + + L + E + EL K R+ E E ++L+ I L L LA+ +K K
Sbjct: 914 LEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKDKHATENK 973

Query: 62 CEELECQLRG 33
+ L ++ G
Sbjct: 974 VKNLTEEMAG 983


tr_hit_id B7P2K8
Definition tr|B7P2K8|B7P2K8_IXOSC Centrosomal protein, putative OS=Ixodes scapularis
Align length 115
Score (bit) 53.5
E-value 5.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911669|Adiantum capillus-veneris mRNA, clone:
YMU001_000007_G07.
(398 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B7P2K8|B7P2K8_IXOSC Centrosomal protein, putative OS=Ixodes s... 54 5e-06
tr|A7QDZ8|A7QDZ8_VITVI Chromosome chr4 scaffold_83, whole genome... 51 2e-05
tr|A7NSY0|A7NSY0_VITVI Chromosome chr18 scaffold_1, whole genome... 51 2e-05
tr|A5ASD5|A5ASD5_VITVI Putative uncharacterized protein OS=Vitis... 50 7e-05
tr|A6SKM4|A6SKM4_BOTFB Putative uncharacterized protein OS=Botry... 47 4e-04
tr|A7NVD8|A7NVD8_VITVI Chromosome chr18 scaffold_1, whole genome... 47 6e-04
tr|Q33BP2|Q33BP2_PAROL Fast skeletal muscle myosin heavy chain (... 46 8e-04
tr|Q1NZ30|Q1NZ30_CAEEL Protein T28C6.9, partially confirmed by t... 46 0.001
tr|Q6C359|Q6C359_YARLI YALI0F02387p OS=Yarrowia lipolytica GN=YA... 46 0.001
tr|Q6QUR8|Q6QUR8_GASAC Myosin heavy chain (Fragment) OS=Gasteros... 45 0.001
tr|Q4STF9|Q4STF9_TETNG Chromosome undetermined SCAF14235, whole ... 44 0.003
tr|Q05K10|Q05K10_ORYLA Fast skeletal myosin heavy chain isoform ... 44 0.003
tr|P87344|P87344_THECH Myosin heavy chain (Fragment) OS=Theragra... 44 0.003
tr|Q9DGD5|Q9DGD5_9PERO Myosin heavy chain OS=Pennahia argentata ... 44 0.004
tr|B8A569|B8A569_DANRE Novel myosin family protein OS=Danio reri... 44 0.004
tr|B8A568|B8A568_DANRE Novel myosin family protein OS=Danio reri... 44 0.004
tr|B3DJM6|B3DJM6_DANRE Si:ch211-158m24.7 OS=Danio rerio GN=myhz1... 44 0.004
tr|Q2GAF1|Q2GAF1_NOVAD Chromosome segregation ATPases-like prote... 44 0.004
tr|Q1PET2|Q1PET2_ARATH Putative uncharacterized protein OS=Arabi... 44 0.004
tr|Q6SNT2|Q6SNT2_SINCH Fast skeletal muscle myosin heavy chain O... 44 0.005
tr|Q05K08|Q05K08_ORYLA Fast skeletal myosin heavy chain isoform ... 44 0.005
tr|Q05K05|Q05K05_ORYLA Fast skeletal myosin heavy chain isoform ... 44 0.005
tr|B1Q385|B1Q385_9TELE Myosin heavy chain OS=Coryphaenoides cine... 44 0.005
tr|B1Q384|B1Q384_9TELE Myosin heavy chain OS=Coryphaenoides acro... 44 0.005
tr|B1Q383|B1Q383_9TELE Myosin heavy chain OS=Coryphaenoides arma... 44 0.005
tr|B1Q382|B1Q382_9TELE Myosin heavy chain OS=Coryphaenoides yaqu... 44 0.005
tr|A4GWV4|A4GWV4_SINKN Skeletal muscle myosin heavy chain OS=Sin... 44 0.005
tr|O44934|O44934_LOLPE Myosin heavy chain isoform A OS=Loligo pe... 44 0.005
tr|Q98TQ5|Q98TQ5_9PERC Myosin heavy chain (Myohc-a3) (Fragment) ... 43 0.007
tr|Q90ZE5|Q90ZE5_DANRE Fast muscle-specific myosin heavy chain (... 43 0.007

>tr|B7P2K8|B7P2K8_IXOSC Centrosomal protein, putative OS=Ixodes
scapularis GN=IscW_ISCW000869 PE=4 SV=1
Length = 708

Score = 53.5 bits (127), Expect = 5e-06
Identities = 38/115 (33%), Positives = 58/115 (50%)
Frame = -1

Query: 392 SEIALVRDQLQQMGDA*AELELQIASISEELGGTKIELGESKDLVINLQSKVAGLHAIEK 213
S +A QL +A +L+ ++A ++ +LG ++EL ESK L + A L K
Sbjct: 61 SALADHSQQLVASSEAQDQLKKEVADLNAKLGRCQVELQESKT---TLAATKADLELTVK 117

Query: 212 NLSEVEAIKVELQGKLREAEGEVNKLQTSIASLTLELAEEKKVHGLAAVKCEELE 48
L +V K EL GKL ++ E L ++ LT ELA + H V+ EEL+
Sbjct: 118 KLDQVSREKQELVGKLEKSAEEAASLNETVKKLTEELAASNRQHRDQMVRLEELQ 172


>tr|A7QDZ8|A7QDZ8_VITVI Chromosome chr4 scaffold_83, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00036801001
PE=4 SV=1
Length = 1032

Score = 51.2 bits (121), Expect = 2e-05
Identities = 35/106 (33%), Positives = 61/106 (57%), Gaps = 6/106 (5%)
Frame = -1

Query: 335 LELQIASISEELGGTKIELGESKDLVINLQSKVAGLHAIEKNLSEV------EAIKVELQ 174
+E+ +A +++L T+++L E + L+ L+S++A L ++L+E E+ K L+
Sbjct: 777 MEMDLARCTQDLESTRLQLKEMEQLLTELKSQLA-LSQKSRSLAETQLKCMTESYK-SLE 834

Query: 173 GKLREAEGEVNKLQTSIASLTLELAEEKKVHGLAAVKCEELECQLR 36
+E E EV LQ + +L EL EEK H A +CE+L+ QL+
Sbjct: 835 LHAQELEAEVISLQEKMENLNYELQEEKDSHQDALARCEDLQEQLQ 880


>tr|A7NSY0|A7NSY0_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00014455001
PE=4 SV=1
Length = 835

Score = 51.2 bits (121), Expect = 2e-05
Identities = 33/119 (27%), Positives = 60/119 (50%), Gaps = 4/119 (3%)
Frame = -1

Query: 371 DQLQQMGDA*AELELQIASISEELGGTKIELGESKDLVINLQSKVAGLHAI----EKNLS 204
++ +Q+ LE+ +A +E L TK +L E++ L+ +S++ + + L
Sbjct: 574 EEFEQLKSEKDTLEMHLARCTENLESTKSQLQETEQLLAEAKSQLTSAQKLNSLADTQLK 633

Query: 203 EVEAIKVELQGKLREAEGEVNKLQTSIASLTLELAEEKKVHGLAAVKCEELECQLRGRE 27
+ L+ + E E EVN L+ +L EL EEK+ H A ++C++L+ QL E
Sbjct: 634 CMAESYRSLETRAEELETEVNLLRGKTETLESELQEEKRSHENALIRCKDLQEQLERNE 692


>tr|A5ASD5|A5ASD5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_000522 PE=4 SV=1
Length = 1085

Score = 49.7 bits (117), Expect = 7e-05
Identities = 32/119 (26%), Positives = 59/119 (49%), Gaps = 4/119 (3%)
Frame = -1

Query: 371 DQLQQMGDA*AELELQIASISEELGGTKIELGESKDLVINLQSKVAGLHAI----EKNLS 204
++ +Q+ LE+ +A +E L TK +L E++ L+ +S++ + + L
Sbjct: 800 EEFEQLKSEKDTLEMHLARCTENLESTKSQLQETEQLLAEAKSQLTSAQKLNSLADTQLK 859

Query: 203 EVEAIKVELQGKLREAEGEVNKLQTSIASLTLELAEEKKVHGLAAVKCEELECQLRGRE 27
+ L+ + E E EVN L+ +L E EEK+ H A ++C++L+ QL E
Sbjct: 860 CMAESYRSLETRAEELETEVNLLRGKTETLESEFQEEKRSHENALIRCKDLQEQLERNE 918


>tr|A6SKM4|A6SKM4_BOTFB Putative uncharacterized protein
OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_13390
PE=4 SV=1
Length = 1066

Score = 47.4 bits (111), Expect = 4e-04
Identities = 33/123 (26%), Positives = 57/123 (46%), Gaps = 4/123 (3%)
Frame = -1

Query: 365 LQQMGDA*AELELQIASISEELGGTKIELGESKDLVINLQSKVA----GLHAIEKNLSEV 198
LQ+ D E+E Q ++ EE+ K ++ E ++ I Q+KVA + +EK
Sbjct: 873 LQRAEDKIKEMEEQASTAQEEVAKAKEKIKEMEEQAITAQTKVAKAEEKIKEMEKQAITA 932

Query: 197 EAIKVELQGKLREAEGEVNKLQTSIASLTLELAEEKKVHGLAAVKCEELECQLRGREFFR 18
+ + + K++E E + N QT +A ++ E +K A K E L+ +E R
Sbjct: 933 QTKVAKAEEKIKEMEKQANTAQTKVAKAEEKIKEMEKQANTAQTKAARAEADLQDKETAR 992

Query: 17 VPA 9
A
Sbjct: 993 QTA 995


>tr|A7NVD8|A7NVD8_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015394001
PE=4 SV=1
Length = 617

Score = 46.6 bits (109), Expect = 6e-04
Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 4/122 (3%)
Frame = -1

Query: 392 SEIALVRDQLQQMGDA*AELELQIASISEELGGTKIELGESKDLV----INLQSKVAGLH 225
+E + +R +L+ M AELE ++ + E +I L S+D + I L+ L
Sbjct: 339 NEDSSLRAELETMTHRMAELEEKLEKMEAEKAELEIALTVSQDCIEASKIQLREAEMKLE 398

Query: 224 AIEKNLSEVEAIKVELQGKLREAEGEVNKLQTSIASLTLELAEEKKVHGLAAVKCEELEC 45
++K L K L+ +L E E + + SL E+ +E + VKC+ELE
Sbjct: 399 EMQKELDFANESKQALESQLIAMEAEARTMSARVDSLEAEIKKEHAMSAEIGVKCQELED 458

Query: 44 QL 39
+L
Sbjct: 459 EL 460


>tr|Q33BP2|Q33BP2_PAROL Fast skeletal muscle myosin heavy chain
(Fragment) OS=Paralichthys olivaceus PE=2 SV=1
Length = 372

Score = 46.2 bits (108), Expect = 8e-04
Identities = 37/109 (33%), Positives = 55/109 (50%), Gaps = 1/109 (0%)
Frame = -1

Query: 371 DQLQQMGDA*AELELQIASISEELGGTKIELGESKDLVINLQSKVAGLHAIEKNLSEVEA 192
DQL+ M L+ +I+ ++E+LG E G+S +H +EK+ VE
Sbjct: 99 DQLETMKRENKNLQQEISDLTEQLG----ETGKS-------------IHELEKSKKTVET 141

Query: 191 IKVELQGKLREAEGEVNKLQTSIASLTLELAEEK-KVHGLAAVKCEELE 48
KVE+Q L EAEG + + I + LEL + K +V A K EE+E
Sbjct: 142 EKVEIQTALEEAEGTLEHEEAKILHVQLELNQIKSEVDRKLAEKDEEME 190


>tr|Q1NZ30|Q1NZ30_CAEEL Protein T28C6.9, partially confirmed by
transcript evidence OS=Caenorhabditis elegans GN=T28C6.9
PE=4 SV=2
Length = 1875

Score = 45.8 bits (107), Expect = 0.001
Identities = 30/122 (24%), Positives = 68/122 (55%), Gaps = 4/122 (3%)
Frame = -1

Query: 389 EIALVRDQLQQMGDA*AELELQIASISEELGGTKIELGESKDLVINLQSKVAGLH---AI 219
++ ++D+LQ++ D EL I+++ +L + EL ++K ++ ++ +G + A
Sbjct: 1565 KVEALQDELQRLKDNEIELTETISALQSKLYDVQSELEDTKQKLVEAENSASGWNDDDAW 1624

Query: 218 EKNLSEVEAIKVELQGKLREAEGEVNKLQTSIASLTLELAEEKKVHGLAAV-KCEELECQ 42
KN +E+E +K L+ ++ + KLQ +++L +L E + L ++ + E+L+ +
Sbjct: 1625 NKNENEIEEVKKALEIEISNRNDTIVKLQNLVSNLRQQLIEASESADLKSLEELEQLKEE 1684

Query: 41 LR 36
LR
Sbjct: 1685 LR 1686


>tr|Q6C359|Q6C359_YARLI YALI0F02387p OS=Yarrowia lipolytica
GN=YALI0F02387g PE=4 SV=1
Length = 1906

Score = 45.8 bits (107), Expect = 0.001
Identities = 35/115 (30%), Positives = 58/115 (50%), Gaps = 7/115 (6%)
Frame = -1

Query: 380 LVRDQLQQMGDA*AE---LELQIASISEE---LGGTKIELGESKDLVINLQSKVAGL-HA 222
L + +GD+ E L+ +I + E L K + S+ + L+ +V+ L +
Sbjct: 1442 LTASHKKALGDSETEAKGLKKEIKAAQAEIKTLEEVKAKYEASQTDIKGLEKQVSELTES 1501

Query: 221 IEKNLSEVEAIKVELQGKLREAEGEVNKLQTSIASLTLELAEEKKVHGLAAVKCE 57
+E SE EA+K L+ KL EA +KL+T + L E+A+ + HG AA + E
Sbjct: 1502 LETKTSETEAVKTALEEKLEEASSAKSKLETKVTELEKEVADNQGKHGKAASELE 1556


>tr|Q6QUR8|Q6QUR8_GASAC Myosin heavy chain (Fragment)
OS=Gasterosteus aculeatus PE=4 SV=1
Length = 654

Score = 45.4 bits (106), Expect = 0.001
Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 1/109 (0%)
Frame = -1

Query: 371 DQLQQMGDA*AELELQIASISEELGGTKIELGESKDLVINLQSKVAGLHAIEKNLSEVEA 192
DQL+ M L+ +I+ ++E++G E G+S +H +EK+ +VE
Sbjct: 245 DQLETMKRENKNLQQEISDLTEQIG----ETGKS-------------IHELEKSKKQVET 287

Query: 191 IKVELQGKLREAEGEVNKLQTSIASLTLELAEEK-KVHGLAAVKCEELE 48
K E+Q L EAEG + ++ I + LEL + K +V A K EE+E
Sbjct: 288 EKTEIQTALEEAEGTLEHEESKILRVQLELNQIKGEVDRKLAEKDEEME 336