BP911699
Clone id YMU001_000008_B06
Library
Length 527
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000008_B06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AATTCGCGGCCGCGAATTGCAATGTTACGGCTCAATGGGACTAGCATATTAACAAGGCCA
AACTAGTCATGCATTAGACTGCATTCAAATCTCAAAAACAGATCGTAATGTAGTCTGCAT
GACCTGTTTAAACCAAACAGAATGCTGTTACAAAATTACTTCACATATGAAATACAATTT
AATCAGTCAGACTGCTCAATCAAATTAAGCCTTTCATAAACCTCCCTCATTGTCGGACGC
TCATTTGGAAGCTCACTCACACAATCACAAGCAACTGCAAAGTAAGCTTGCACTTGATTG
GAAGGAGGTGGCACCTTCTTGAAAACTGTGTCCAACACATCCATCTCATAACCAAGCTGA
TGCATGTGACGAGACCATTTTGCCAATGACCTAAAATTCTTCTCTTGGATTAGCAGATTG
GGACGCCTACCAGTACCAAGCTCCAGCATTACCATACCAAAACTGTATACATCAGCTTGC
TTTGTTGCACATAGTGTCATAGCATACTCAGGTGCCATATAGCCCAA
■■Homology search results ■■ -
sp_hit_id Q9C7S5
Definition sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana
Align length 111
Score (bit) 78.6
E-value 2.0e-14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911699|Adiantum capillus-veneris mRNA, clone:
YMU001_000008_B06.
(509 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 ... 79 2e-14
sp|O04567|Y1719_ARATH Probable inactive receptor kinase At1g2719... 75 1e-13
sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis t... 72 2e-12
sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota... 72 2e-12
sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis t... 68 3e-11
sp|Q9S9M3|WAKLC_ARATH Wall-associated receptor kinase-like 3 OS=... 67 6e-11
sp|Q9LVI6|RLK90_ARATH Probable inactive receptor kinase RLK902 O... 65 2e-10
sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase ... 65 2e-10
sp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 2 OS=... 65 2e-10
sp|O48788|Y2267_ARATH Probable inactive receptor kinase At2g2673... 64 4e-10
sp|Q0WNY5|WAKLN_ARATH Wall-associated receptor kinase-like 18 OS... 64 5e-10
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidops... 64 5e-10
sp|Q9C8M9|SRF6_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 6 OS=Ara... 63 9e-10
sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidops... 63 9e-10
sp|Q9S9M5|WAKLA_ARATH Wall-associated receptor kinase-like 1 OS=... 62 1e-09
sp|Q6R2J8|SRF8_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Ara... 62 1e-09
sp|Q3EDL4|Y1154_ARATH Putative serine/threonine-protein kinase A... 62 2e-09
sp|Q9S9M2|WAKLD_ARATH Wall-associated receptor kinase-like 4 OS=... 62 2e-09
sp|Q9LUL4|SRF7_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 7 OS=Ara... 62 2e-09
sp|Q9LQQ8|RLCK7_ARATH Probable serine/threonine-protein kinase R... 62 2e-09
sp|Q9LVM0|Y5830_ARATH Probable inactive receptor kinase At5g5830... 61 3e-09
sp|Q9M092|WAKLM_ARATH Wall-associated receptor kinase-like 17 OS... 61 3e-09
sp|Q9M8T0|Y3288_ARATH Probable inactive receptor kinase At3g0288... 61 3e-09
sp|Q8RY17|WAKLI_ARATH Wall-associated receptor kinase-like 22 OS... 61 3e-09
sp|Q9S9M1|WAKLE_ARATH Wall-associated receptor kinase-like 5 OS=... 61 3e-09
sp|Q9C5S8|CRK5_ARATH Cysteine-rich receptor-like protein kinase ... 61 3e-09
sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabido... 61 3e-09
sp|O49564|CRK27_ARATH Cysteine-rich receptor-like protein kinase... 60 5e-09
sp|Q9LP77|Y1848_ARATH Probable inactive receptor kinase At1g4848... 60 6e-09
sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2... 60 6e-09

>sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1
OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1
Length = 1095

Score = 78.6 bits (192), Expect = 2e-14
Identities = 43/111 (38%), Positives = 64/111 (57%)
Frame = -1

Query: 509 LGYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRPNLLIQEKNFRSLAKWSRHMHQLGY 330
LGY+ PEY AT + DVYSFG+VMLEL TG+RP + + K R L W M + G
Sbjct: 969 LGYIPPEYGQAWVATLRGDVYSFGVVMLELLTGKRPMEVFRPKMSRELVAWVHTMKRDGK 1028

Query: 329 EMDVLDTVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLNLIE 177
+V DT+ ++ ++ +AC CV++ P +RP +++V + L IE
Sbjct: 1029 PEEVFDTLLRESGNEEAMLRV-LDIACMCVNQNPMKRPNIQQVVDWLKNIE 1078


>sp|O04567|Y1719_ARATH Probable inactive receptor kinase At1g27190
OS=Arabidopsis thaliana GN=At1g27190 PE=1 SV=1
Length = 601

Score = 75.5 bits (184), Expect = 1e-13
Identities = 44/110 (40%), Positives = 64/110 (58%), Gaps = 3/110 (2%)
Frame = -1

Query: 509 LGYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRPNLLIQ-EKNFR-SLAKWSRHMHQL 336
LGY+APEY+ T+ A+ + DVY FG+V+LEL TG++P +I + F+ SL W
Sbjct: 469 LGYVAPEYSSTMVASLKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGT 528

Query: 335 GYEMDVLD-TVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERL 189
G D +D ++ K ++ + +AC CV P ERPTM +VYE L
Sbjct: 529 GRSKDAIDRSICDK--GHDEEILQFLKIACSCVVSRPKERPTMIQVYESL 576


>sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis
thaliana GN=PSKR2 PE=2 SV=1
Length = 1036

Score = 72.0 bits (175), Expect = 2e-12
Identities = 40/103 (38%), Positives = 57/103 (55%)
Frame = -1

Query: 509 LGYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRPNLLIQEKNFRSLAKWSRHMHQLGY 330
LGY+ PEY+ +L AT + DVYSFG+V+LEL TGRRP + + K+ R L M
Sbjct: 920 LGYIPPEYSQSLIATCRGDVYSFGVVLLELVTGRRPVEVCKGKSCRDLVSRVFQMKAEKR 979

Query: 329 EMDVLDTVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREV 201
E +++DT ++ V +AC C+ P RP + EV
Sbjct: 980 EAELIDTTIRE-NVNERTVLEMLEIACKCIDHEPRRRPLIEEV 1021


>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota
GN=PSKR PE=1 SV=1
Length = 1021

Score = 72.0 bits (175), Expect = 2e-12
Identities = 41/113 (36%), Positives = 59/113 (52%)
Frame = -1

Query: 509 LGYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRPNLLIQEKNFRSLAKWSRHMHQLGY 330
LGY+ PEY AT + DVYSFG+V+LEL TGRRP + + + R L W M
Sbjct: 909 LGYIPPEYGQASVATYKGDVYSFGVVLLELLTGRRPMDVCKPRGSRDLISWVLQMKTEKR 968

Query: 329 EMDVLDTVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLNLIEQS 171
E ++ D F + ++ +AC C+ E P RPT +++ L I+ S
Sbjct: 969 ESEIFDP-FIYDKDHAEEMLLVLEIACRCLGENPKTRPTTQQLVSWLENIDVS 1020


>sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis
thaliana GN=PSKR1 PE=2 SV=4
Length = 1008

Score = 67.8 bits (164), Expect = 3e-11
Identities = 38/108 (35%), Positives = 56/108 (51%)
Frame = -1

Query: 509 LGYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRPNLLIQEKNFRSLAKWSRHMHQLGY 330
LGY+ PEY AT + DVYSFG+V+LEL T +RP + + K R L W M
Sbjct: 900 LGYIPPEYGQASVATYKGDVYSFGVVLLELLTDKRPVDMCKPKGCRDLISWVVKMKHESR 959

Query: 329 EMDVLDTVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLN 186
+V D + ++ +AC C+SE P +RPT +++ L+
Sbjct: 960 ASEVFDPLIYS-KENDKEMFRVLEIACLCLSENPKQRPTTQQLVSWLD 1006


>sp|Q9S9M3|WAKLC_ARATH Wall-associated receptor kinase-like 3
OS=Arabidopsis thaliana GN=WAKL3 PE=2 SV=2
Length = 730

Score = 66.6 bits (161), Expect = 6e-11
Identities = 39/112 (34%), Positives = 62/112 (55%)
Frame = -1

Query: 506 GYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRPNLLIQEKNFRSLAKWSRHMHQLGYE 327
GYM PEY ++ T ++DVYSFG+V++EL TG +P ++ + LA + +
Sbjct: 594 GYMDPEYFLSSQYTHKSDVYSFGVVLVELITGEKPMSRVRSEEGIGLATYFLEAMKENRA 653

Query: 326 MDVLDTVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLNLIEQS 171
+D++D ++ S QV A +A C++ N+RP MREV +L I S
Sbjct: 654 VDIIDI---RIKDESKQVMAVAKLARRCLNRKGNKRPNMREVSIKLERIRSS 702


>sp|Q9LVI6|RLK90_ARATH Probable inactive receptor kinase RLK902
OS=Arabidopsis thaliana GN=RLK902 PE=1 SV=1
Length = 647

Score = 65.1 bits (157), Expect = 2e-10
Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 3/115 (2%)
Frame = -1

Query: 506 GYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRPNLLIQEKNFRSLAKWSRHMHQLGYE 327
GY APE +++ADVYSFG+V+LEL TG+ P+ + + LA+W + + +
Sbjct: 527 GYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVAREEWR 586

Query: 326 MDVLDT---VFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLNLIEQS 171
+V D+ + V ++ + DC + P++RP M EV R+ + QS
Sbjct: 587 NEVFDSELMSIETVVSVEEEMAEMLQLGIDCTEQHPDKRPVMVEVVRRIQELRQS 641


>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS
OS=Arabidopsis thaliana GN=EXS PE=1 SV=1
Length = 1192

Score = 65.1 bits (157), Expect = 2e-10
Identities = 38/110 (34%), Positives = 61/110 (55%), Gaps = 1/110 (0%)
Frame = -1

Query: 506 GYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRP-NLLIQEKNFRSLAKWSRHMHQLGY 330
GY+ PEY + AT + DVYSFG+++LEL TG+ P +E +L W+ G
Sbjct: 1084 GYIPPEYGQSARATTKGDVYSFGVILLELVTGKEPTGPDFKESEGGNLVGWAIQKINQGK 1143

Query: 329 EMDVLDTVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLNLI 180
+DV+D + V ++Q++ +A C++E P +RP M +V + L I
Sbjct: 1144 AVDVIDPLLVSVALKNSQLR-LLQIAMLCLAETPAKRPNMLDVLKALKEI 1192


>sp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 2
OS=Arabidopsis thaliana GN=WAKL2 PE=2 SV=1
Length = 748

Score = 64.7 bits (156), Expect = 2e-10
Identities = 41/114 (35%), Positives = 63/114 (55%), Gaps = 2/114 (1%)
Frame = -1

Query: 506 GYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRPNLLIQEKNFRSLAKWSRHMHQLGYE 327
GY+ PEY + T+++DVYSFG+V++EL TG +P+ ++ + R LA H + E
Sbjct: 582 GYVDPEYFQSSKFTEKSDVYSFGVVLVELLTGEKPSSRVRSEENRGLA---AHFVEAVKE 638

Query: 326 MDVLDTVFKKVPPPSN--QVQAYFAVACDCVSELPNERPTMREVYERLNLIEQS 171
VLD V ++ N QV + +A C++ +RP MREV L +I S
Sbjct: 639 NRVLDIVDDRIKDECNMDQVMSVANLARRCLNRKGKKRPNMREVSIELEMIRSS 692


>sp|O48788|Y2267_ARATH Probable inactive receptor kinase At2g26730
OS=Arabidopsis thaliana GN=At2g26730 PE=1 SV=1
Length = 658

Score = 63.9 bits (154), Expect = 4e-10
Identities = 35/113 (30%), Positives = 59/113 (52%)
Frame = -1

Query: 506 GYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRPNLLIQEKNFRSLAKWSRHMHQLGYE 327
GY APE T T ++DVYSFG+++LEL TG+ PN + L +W + + +
Sbjct: 511 GYHAPEVLETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWT 570

Query: 326 MDVLDTVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLNLIEQSD 168
+V D + ++ +A CVS +P++RP M+EV + + +S+
Sbjct: 571 AEVFDVELMRYHNIEEEMVQLLQIAMACVSTVPDQRPVMQEVLRMIEDVNRSE 623


tr_hit_id B6SV38
Definition tr|B6SV38|B6SV38_MAIZE BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 OS=Zea mays
Align length 112
Score (bit) 88.2
E-value 2.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911699|Adiantum capillus-veneris mRNA, clone:
YMU001_000008_B06.
(509 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6SV38|B6SV38_MAIZE BRASSINOSTEROID INSENSITIVE 1-associated ... 88 2e-16
tr|Q6AUA1|Q6AUA1_ORYSJ Os05g0414700 protein OS=Oryza sativa subs... 85 2e-15
tr|A3B419|A3B419_ORYSJ Putative uncharacterized protein OS=Oryza... 85 2e-15
tr|B8AYA2|B8AYA2_ORYSI Putative uncharacterized protein OS=Oryza... 85 2e-15
tr|A9TG65|A9TG65_PHYPA Predicted protein OS=Physcomitrella paten... 84 4e-15
tr|Q53JL7|Q53JL7_ORYSJ Protein kinase domain containing protein,... 81 3e-14
tr|Q0ITI9|Q0ITI9_ORYSJ Os11g0249900 protein (Fragment) OS=Oryza ... 81 3e-14
tr|A3CA80|A3CA80_ORYSJ Putative uncharacterized protein OS=Oryza... 81 3e-14
tr|A2ZD38|A2ZD38_ORYSI Putative uncharacterized protein OS=Oryza... 81 3e-14
tr|B8XA57|B8XA57_GOSBA Receptor kinase OS=Gossypium barbadense P... 80 7e-14
tr|A2Q5X8|A2Q5X8_MEDTR Protein kinase OS=Medicago truncatula GN=... 80 7e-14
tr|Q67IT9|Q67IT9_ORYSJ Os02g0153100 protein OS=Oryza sativa subs... 79 1e-13
tr|Q66RK3|Q66RK3_ORYSJ Putative leucine-rich repeat receptor-lik... 79 1e-13
tr|Q5Z675|Q5Z675_ORYSJ Os06g0691800 protein OS=Oryza sativa subs... 79 1e-13
tr|Q5UD34|Q5UD34_ORYRU Putative leucine-rich repeat receptor-lik... 79 1e-13
tr|A2YGG8|A2YGG8_ORYSI Putative uncharacterized protein OS=Oryza... 79 1e-13
tr|A7P692|A7P692_VITVI Chromosome chr9 scaffold_7, whole genome ... 79 1e-13
tr|A7P1Q9|A7P1Q9_VITVI Chromosome chr19 scaffold_4, whole genome... 79 1e-13
tr|A5BTZ5|A5BTZ5_VITVI Putative uncharacterized protein OS=Vitis... 79 1e-13
tr|A5AEK7|A5AEK7_VITVI Putative uncharacterized protein OS=Vitis... 79 1e-13
tr|Q9FIH3|Q9FIH3_ARATH Serine/threonine protein kinase-like prot... 78 2e-13
tr|Q67IS9|Q67IS9_ORYSJ Os02g0154200 protein OS=Oryza sativa subs... 78 2e-13
tr|Q5UD41|Q5UD41_ORYRU Putative leucine-rich repeat receptor-lik... 78 2e-13
tr|A9SE46|A9SE46_PHYPA Predicted protein OS=Physcomitrella paten... 77 6e-13
tr|Q67IT7|Q67IT7_ORYSJ Os02g0153400 protein OS=Oryza sativa subs... 76 8e-13
tr|Q67IT2|Q67IT2_ORYSJ Os02g0153900 protein OS=Oryza sativa subs... 76 8e-13
tr|Q66QA4|Q66QA4_ORYSI Putative leucine-rich repeat receptor-lik... 76 8e-13
tr|Q5UD39|Q5UD39_ORYRU Putative leucine-rich repeat receptor-lik... 76 8e-13
tr|Q5UD36|Q5UD36_ORYRU Putative leucine-rich repeat receptor-lik... 76 8e-13
tr|A2X110|A2X110_ORYSI Putative uncharacterized protein OS=Oryza... 76 8e-13

>tr|B6SV38|B6SV38_MAIZE BRASSINOSTEROID INSENSITIVE 1-associated
receptor kinase 1 OS=Zea mays PE=2 SV=1
Length = 606

Score = 88.2 bits (217), Expect = 2e-16
Identities = 50/112 (44%), Positives = 64/112 (57%), Gaps = 2/112 (1%)
Frame = -1

Query: 509 LGYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRP-NLLIQEKNFR-SLAKWSRHMHQL 336
LGY+APEYA TL AT + DVYSFG+V+LEL TG RP ++ +NFR SL +W H+
Sbjct: 463 LGYVAPEYARTLVATPKGDVYSFGVVLLELVTGERPTHVSSAPENFRGSLVEWISHLSNN 522

Query: 335 GYEMDVLDTVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLNLI 180
D +D ++ + VAC C P ERPTM EVY+ L I
Sbjct: 523 ALLQDAIDKSL-VAKDADGELMQFLKVACSCTLATPKERPTMFEVYQLLRAI 573


>tr|Q6AUA1|Q6AUA1_ORYSJ Os05g0414700 protein OS=Oryza sativa subsp.
japonica GN=P0017D10.20 PE=4 SV=1
Length = 607

Score = 85.1 bits (209), Expect = 2e-15
Identities = 50/113 (44%), Positives = 67/113 (59%), Gaps = 3/113 (2%)
Frame = -1

Query: 509 LGYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRP-NLLIQEKNFR-SLAKWSRHMHQL 336
LGY+APEYA TL AT + DVYSFG+V+LEL TG RP ++ +NFR SL +W ++
Sbjct: 465 LGYVAPEYARTLVATPKGDVYSFGVVLLELITGERPTHVSTAPENFRGSLVEWINYLSNN 524

Query: 335 GYEMDVLD-TVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLNLI 180
D +D ++ K ++ + VAC C P ERPTM EVY+ L I
Sbjct: 525 ALLQDAVDKSLIGK--GSDGELMQFLKVACSCTISTPKERPTMFEVYQLLRAI 575


>tr|A3B419|A3B419_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_017791 PE=4 SV=1
Length = 627

Score = 85.1 bits (209), Expect = 2e-15
Identities = 50/113 (44%), Positives = 67/113 (59%), Gaps = 3/113 (2%)
Frame = -1

Query: 509 LGYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRP-NLLIQEKNFR-SLAKWSRHMHQL 336
LGY+APEYA TL AT + DVYSFG+V+LEL TG RP ++ +NFR SL +W ++
Sbjct: 485 LGYVAPEYARTLVATPKGDVYSFGVVLLELITGERPTHVSTAPENFRGSLVEWINYLSNN 544

Query: 335 GYEMDVLD-TVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLNLI 180
D +D ++ K ++ + VAC C P ERPTM EVY+ L I
Sbjct: 545 ALLQDAVDKSLIGK--GSDGELMQFLKVACSCTISTPKERPTMFEVYQLLRAI 595


>tr|B8AYA2|B8AYA2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_19968 PE=4 SV=1
Length = 930

Score = 84.7 bits (208), Expect = 2e-15
Identities = 50/113 (44%), Positives = 67/113 (59%), Gaps = 3/113 (2%)
Frame = -1

Query: 509 LGYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRP-NLLIQEKNFR-SLAKWSRHMHQL 336
LGY+APEYA TL AT + DVYSFG+V+LEL TG RP ++ +NFR SL +W ++
Sbjct: 465 LGYVAPEYARTLVATPKGDVYSFGVVLLELITGERPTHVSTAPENFRGSLVEWITYLSNN 524

Query: 335 GYEMDVLD-TVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLNLI 180
D +D ++ K ++ + VAC C P ERPTM EVY+ L I
Sbjct: 525 ALLQDAVDKSLIGK--GSDGELMQFLKVACSCTISTPKERPTMFEVYQLLRAI 575


>tr|A9TG65|A9TG65_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_145093 PE=4 SV=1
Length = 602

Score = 84.0 bits (206), Expect = 4e-15
Identities = 42/112 (37%), Positives = 70/112 (62%)
Frame = -1

Query: 506 GYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRPNLLIQEKNFRSLAKWSRHMHQLGYE 327
GY+APE+A + AT++ DVYS+G+++LEL +GRR ++ +LA W R ++ G
Sbjct: 463 GYVAPEFAKSGRATEKVDVYSYGVILLELLSGRRAVDEDMSDDYTNLAGWVRELNSTGKS 522

Query: 326 MDVLDTVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLNLIEQS 171
M+V+D + PS +++ +AC C+S P +RPTM +V E L L+ ++
Sbjct: 523 MEVVDKNLRDT-VPSVELELLLEIACHCISLKPQDRPTMHKVVETLELLTET 573


>tr|Q53JL7|Q53JL7_ORYSJ Protein kinase domain containing protein,
expressed OS=Oryza sativa subsp. japonica
GN=LOC_Os11g14420 PE=4 SV=1
Length = 606

Score = 81.3 bits (199), Expect = 3e-14
Identities = 48/112 (42%), Positives = 63/112 (56%), Gaps = 2/112 (1%)
Frame = -1

Query: 509 LGYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRPNLLIQ-EKNFR-SLAKWSRHMHQL 336
LGY+APEYA TL AT + DVYSFG+V+LEL TG P + +NF+ SL W ++
Sbjct: 464 LGYVAPEYARTLVATPKGDVYSFGVVLLELVTGEEPTQVKNAPENFKGSLVDWITYLSNN 523

Query: 335 GYEMDVLDTVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLNLI 180
D +D + +Q + VAC CV P ERPTM EVY+ + I
Sbjct: 524 AILQDAVDKSLIGKDHDAELLQ-FMKVACSCVLSAPKERPTMFEVYQLMRAI 574


>tr|Q0ITI9|Q0ITI9_ORYSJ Os11g0249900 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os11g0249900 PE=4 SV=1
Length = 501

Score = 81.3 bits (199), Expect = 3e-14
Identities = 48/112 (42%), Positives = 63/112 (56%), Gaps = 2/112 (1%)
Frame = -1

Query: 509 LGYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRPNLLIQ-EKNFR-SLAKWSRHMHQL 336
LGY+APEYA TL AT + DVYSFG+V+LEL TG P + +NF+ SL W ++
Sbjct: 359 LGYVAPEYARTLVATPKGDVYSFGVVLLELVTGEEPTQVKNAPENFKGSLVDWITYLSNN 418

Query: 335 GYEMDVLDTVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLNLI 180
D +D + +Q + VAC CV P ERPTM EVY+ + I
Sbjct: 419 AILQDAVDKSLIGKDHDAELLQ-FMKVACSCVLSAPKERPTMFEVYQLMRAI 469


>tr|A3CA80|A3CA80_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_032202 PE=4 SV=1
Length = 634

Score = 81.3 bits (199), Expect = 3e-14
Identities = 48/112 (42%), Positives = 63/112 (56%), Gaps = 2/112 (1%)
Frame = -1

Query: 509 LGYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRPNLLIQ-EKNFR-SLAKWSRHMHQL 336
LGY+APEYA TL AT + DVYSFG+V+LEL TG P + +NF+ SL W ++
Sbjct: 492 LGYVAPEYARTLVATPKGDVYSFGVVLLELVTGEEPTQVKNAPENFKGSLVDWITYLSNN 551

Query: 335 GYEMDVLDTVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLNLI 180
D +D + +Q + VAC CV P ERPTM EVY+ + I
Sbjct: 552 AILQDAVDKSLIGKDHDAELLQ-FMKVACSCVLSAPKERPTMFEVYQLMRAI 602


>tr|A2ZD38|A2ZD38_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_35701 PE=4 SV=1
Length = 525

Score = 81.3 bits (199), Expect = 3e-14
Identities = 48/112 (42%), Positives = 63/112 (56%), Gaps = 2/112 (1%)
Frame = -1

Query: 509 LGYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRPNLLIQ-EKNFR-SLAKWSRHMHQL 336
LGY+APEYA TL AT + DVYSFG+V+LEL TG P + +NF+ SL W ++
Sbjct: 383 LGYVAPEYARTLVATPKGDVYSFGVVLLELVTGEEPTQVKNAPENFKGSLVDWITYLSNN 442

Query: 335 GYEMDVLDTVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERLNLI 180
D +D + +Q + VAC CV P ERPTM EVY+ + I
Sbjct: 443 SILQDAVDKSLIGKDHDAELLQ-FMKVACSCVLSAPKERPTMFEVYQLMRAI 493


>tr|B8XA57|B8XA57_GOSBA Receptor kinase OS=Gossypium barbadense PE=2
SV=1
Length = 1085

Score = 79.7 bits (195), Expect = 7e-14
Identities = 43/107 (40%), Positives = 62/107 (57%)
Frame = -1

Query: 509 LGYMAPEYAMTLCATKQADVYSFGMVMLELGTGRRPNLLIQEKNFRSLAKWSRHMHQLGY 330
LGY+ PEY AT + DVYSFG+VMLEL TG+RP + + K R L W + + G
Sbjct: 966 LGYIPPEYGQAWVATLRGDVYSFGVVMLELLTGKRPVDMSRPKTSRELVSWVQRLRSEGK 1025

Query: 329 EMDVLDTVFKKVPPPSNQVQAYFAVACDCVSELPNERPTMREVYERL 189
+ +V D + K ++ VAC C+++ P +RPT++EV E L
Sbjct: 1026 QDEVFDPLLKGKGSDEEMLRV-LDVACLCINQNPFKRPTIQEVVEWL 1071