BP911742
Clone id YMU001_000008_F06
Library
Length 474
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000008_F06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AATTTCCACACTACTTGCACCGTTTCTGTGCTCATCAATCTCAGGCACCTTGCAGTCAAA
GACTAAATCAGCAAAATTCACATTCAGCTTCCTCTTTGTAAACTTGATTGGTTCCTTTCC
GTAACTGCGATCACTTAGATGGGAAGTCTCCTTGAAGTAGTGTTTATGCCTATTGACTGC
TTATAGTGCAGGGTTTCACCCTTGCAAGCACAAACCCATCCAATCCTGCTGTATGCAAAA
CACCAATCCCTTCACAAAACCAGCATGGTTGATCGTCTTGTGCTTCATTCTTCGTCCATT
TCATGATAGCGTTGTCAGGAAGGCCTGAACCTCTGCATCTGGGACATTTACGATGACTTC
CTCCGGTATGGTCTAGAATAAGAGTGATATTTCTCGCCACATCTTGCAGTACTTCCCACA
TGTTTCTATGTTGATGCTGCAGGTAGCCGATCGTCTCGACGAACGTTTTATCTG
■■Homology search results ■■ -
sp_hit_id Q9PK60
Definition sp|Q9PK60|UVRA_CHLMU UvrABC system protein A OS=Chlamydia muridarum
Align length 64
Score (bit) 31.6
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911742|Adiantum capillus-veneris mRNA, clone:
YMU001_000008_F06.
(474 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9PK60|UVRA_CHLMU UvrABC system protein A OS=Chlamydia murida... 32 1.9
sp|Q8C3L1|CC032_MOUSE Uncharacterized protein C3orf32 homolog OS... 30 5.4
sp|Q18GZ3|DNAJ_HALWD Chaperone protein dnaJ OS=Haloquadratum wal... 30 7.1
sp|Q04960|DNJH_CUCSA DnaJ protein homolog OS=Cucumis sativus GN=... 29 9.3

>sp|Q9PK60|UVRA_CHLMU UvrABC system protein A OS=Chlamydia muridarum
GN=uvrA PE=3 SV=1
Length = 1787

Score = 31.6 bits (70), Expect = 1.9
Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 6/64 (9%)
Frame = -3

Query: 469 KTFVETIGYLQHQHRNMWEVLQDVARNITLILDHT-----GGSHRKCPRCRGSGLPDNA- 308
K F T+G H+ VL ++ I + G S+ +CPRC+ +GL D A
Sbjct: 350 KLFDGTLGKTTQTHKQWKGVLNEIGEKIRFANKPSRYLPKGTSYTECPRCQKTGLSDYAN 409

Query: 307 IMKW 296
KW
Sbjct: 410 AAKW 413


>sp|Q8C3L1|CC032_MOUSE Uncharacterized protein C3orf32 homolog
OS=Mus musculus PE=2 SV=1
Length = 340

Score = 30.0 bits (66), Expect = 5.4
Identities = 13/41 (31%), Positives = 19/41 (46%)
Frame = -3

Query: 364 GGSHRKCPRCRGSGLPDNAIMKWTKNEAQDDQPCWFCEGIG 242
G KC C G+G+ + TK +A+ + C C G G
Sbjct: 183 GRGRYKCSGCHGAGMVRCSSCSGTKRKAKQPRRCHLCSGSG 223


>sp|Q18GZ3|DNAJ_HALWD Chaperone protein dnaJ OS=Haloquadratum
walsbyi (strain DSM 16790) GN=dnaJ PE=3 SV=1
Length = 387

Score = 29.6 bits (65), Expect = 7.1
Identities = 13/41 (31%), Positives = 19/41 (46%)
Frame = -3

Query: 352 RKCPRCRGSGLPDNAIMKWTKNEAQDDQPCWFCEGIGVLHT 230
R CP+C G G + + Q Q C C+G G ++T
Sbjct: 176 RTCPQCNGQG-QTTTVRETALGRVQQTQTCPRCDGSGEMYT 215


>sp|Q04960|DNJH_CUCSA DnaJ protein homolog OS=Cucumis sativus
GN=DNAJ1 PE=2 SV=1
Length = 413

Score = 29.3 bits (64), Expect = 9.3
Identities = 14/40 (35%), Positives = 19/40 (47%)
Frame = -3

Query: 361 GSHRKCPRCRGSGLPDNAIMKWTKNEAQDDQPCWFCEGIG 242
G+ KCP C+GSG+ + Q PC C+G G
Sbjct: 157 GASMKCPGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTG 196


tr_hit_id A9TXB3
Definition tr|A9TXB3|A9TXB3_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 90
Score (bit) 59.7
E-value 7.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911742|Adiantum capillus-veneris mRNA, clone:
YMU001_000008_F06.
(474 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TXB3|A9TXB3_PHYPA Predicted protein OS=Physcomitrella paten... 60 7e-08
tr|A9ST62|A9ST62_PHYPA Predicted protein OS=Physcomitrella paten... 57 4e-07
tr|A9RVZ4|A9RVZ4_PHYPA Predicted protein OS=Physcomitrella paten... 52 2e-05
tr|A9TXC6|A9TXC6_PHYPA Predicted protein (Fragment) OS=Physcomit... 35 2.4
tr|B4ET75|B4ET75_PROMH Putative hydrolase OS=Proteus mirabilis (... 34 3.2
tr|Q88NI2|Q88NI2_PSEPK Membrane protein, putative OS=Pseudomonas... 33 5.4
tr|A5VZV7|A5VZV7_PSEP1 Cation efflux protein OS=Pseudomonas puti... 33 5.4
tr|Q30CS1|Q30CS1_STRAU LipPks2 OS=Streptomyces aureofaciens GN=l... 33 7.1
tr|B0KTI2|B0KTI2_PSEPG Cation efflux protein OS=Pseudomonas puti... 33 9.3
tr|A3T368|A3T368_9RHOB Putative uncharacterized protein OS=Sulfi... 33 9.3

>tr|A9TXB3|A9TXB3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_98525 PE=4 SV=1
Length = 622

Score = 59.7 bits (143), Expect = 7e-08
Identities = 32/90 (35%), Positives = 44/90 (48%), Gaps = 15/90 (16%)
Frame = -3

Query: 415 EVLQDVARNITLILDHTGGSHRKCPRCRGSGLPDNAIMKWTKNEAQDDQPCWFCEGI--- 245
E + A N+T I T KCPRC+GSGL + +T+ ++PCWFCEG+
Sbjct: 181 ESARSFANNVTEIFRKTDCKRSKCPRCKGSGLHMDL---FTEKSPYSNEPCWFCEGLAPT 237

Query: 244 ------------GVLHTAGLDGFVLARVKP 191
GV+ AG DG++L R P
Sbjct: 238 FLHTPAVIFSWMGVMSVAGTDGYMLGRSNP 267


>tr|A9ST62|A9ST62_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_234081 PE=4 SV=1
Length = 417

Score = 57.4 bits (137), Expect = 4e-07
Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
Frame = -3

Query: 400 VARNITLILDHTGGSHRKCPRCRGSGLPDNAIMKWTKNEAQD-DQPCWFCEGIGVLHTAG 224
+A N G KCPRC+GSGL K + + + + + PCWFCEG+GV+ A
Sbjct: 11 LAENAAEAFGKADGEPSKCPRCKGSGLHMEPSTKNSHSTSTNSNNPCWFCEGMGVMAVAS 70

Query: 223 LDGFVLAR 200
DG++L R
Sbjct: 71 TDGYMLGR 78


>tr|A9RVZ4|A9RVZ4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_161249 PE=4 SV=1
Length = 326

Score = 51.6 bits (122), Expect = 2e-05
Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 5/79 (6%)
Frame = -3

Query: 421 MWEVLQDVA---RNITLILDHTGGSHRKCPRCRGSGLPDNAIMK-WTKNEAQD-DQPCWF 257
M +V+Q A +++ IL G+ KCPRC+GSGL A+ W+ + + C F
Sbjct: 1 MVDVIQRTALFLQDVREILRKRDGNRAKCPRCKGSGLL--ALQPCWSHGQPNSSNSSCLF 58

Query: 256 CEGIGVLHTAGLDGFVLAR 200
CEG+GV+ GL G++L R
Sbjct: 59 CEGVGVMPVVGLRGYILGR 77


>tr|A9TXC6|A9TXC6_PHYPA Predicted protein (Fragment) OS=Physcomitrella
patens subsp. patens GN=PHYPADRAFT_172515 PE=4 SV=1
Length = 960

Score = 34.7 bits (78), Expect = 2.4
Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 1/66 (1%)
Frame = -1

Query: 195 NPAL*AVNR-HKHYFKETSHLSDRSYGKEPIKFTKRKLNVNFADLVFDCKVPEIDEHRNG 19
+PA A N H ++ + + DR Y E + + V+F DC + + HRNG
Sbjct: 807 HPAALASNTSHTNFERASGSYDDRRYSDESVHGAGGQRRVSFPAAKIDCDLRQQHSHRNG 866

Query: 18 ASSVEI 1
SS E+
Sbjct: 867 YSSAEL 872


>tr|B4ET75|B4ET75_PROMH Putative hydrolase OS=Proteus mirabilis
(strain HI4320) GN=PMI0806 PE=4 SV=1
Length = 285

Score = 34.3 bits (77), Expect = 3.2
Identities = 14/42 (33%), Positives = 22/42 (52%)
Frame = -3

Query: 322 LPDNAIMKWTKNEAQDDQPCWFCEGIGVLHTAGLDGFVLARV 197
LPDN + W ++ D QP FC G G+ +D +L ++
Sbjct: 13 LPDNRTLTWYESGPSDGQPVLFCTGAGMSGLLSMDADLLTKL 54


>tr|Q88NI2|Q88NI2_PSEPK Membrane protein, putative OS=Pseudomonas
putida (strain KT2440) GN=PP1227 PE=4 SV=1
Length = 319

Score = 33.5 bits (75), Expect = 5.4
Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 5/97 (5%)
Frame = +2

Query: 140 WEVSLK*CLCLLTAYSAGFHPCKHKPIQSCCMQNTNPFTKPAWLIVLCFILRPFHDSVVR 319
W +S LL A+ G+ +Q ++ +P+ PA L ++C ++ P SVVR
Sbjct: 169 WVMSASITAALLIAFCFGY------AVQGTALEWVSPYIDPAVLALVCLVIVPLPMSVVR 222

Query: 320 KA*TSASGTFTMTSSGMV*N-----KSDISRHILQYF 415
+A S F +T + + K+ ++RH LQ +
Sbjct: 223 QA---LSEIFLVTPGDLKLHVDEVAKAFVARHGLQSY 256


>tr|A5VZV7|A5VZV7_PSEP1 Cation efflux protein OS=Pseudomonas putida
(strain F1 / ATCC 700007) GN=Pput_1256 PE=4 SV=1
Length = 319

Score = 33.5 bits (75), Expect = 5.4
Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 5/97 (5%)
Frame = +2

Query: 140 WEVSLK*CLCLLTAYSAGFHPCKHKPIQSCCMQNTNPFTKPAWLIVLCFILRPFHDSVVR 319
W +S LL A+ G+ +Q ++ +P+ PA L ++C ++ P SVVR
Sbjct: 169 WVMSASITAALLIAFCFGY------AVQGTALEWVSPYIDPAVLALVCLVIVPLPMSVVR 222

Query: 320 KA*TSASGTFTMTSSGMV*N-----KSDISRHILQYF 415
+A S F +T + + K+ ++RH LQ +
Sbjct: 223 QA---LSEIFLVTPGDLKLHVDEVAKAFVARHGLQSY 256


>tr|Q30CS1|Q30CS1_STRAU LipPks2 OS=Streptomyces aureofaciens
GN=lipPks2 PE=4 SV=1
Length = 3582

Score = 33.1 bits (74), Expect = 7.1
Identities = 15/35 (42%), Positives = 22/35 (62%)
Frame = -1

Query: 366 PEEVIVNVPDAEVQAFLTTLS*NGRRMKHKTINHA 262
PE V+V+ + EV+ TL GRR+K T++HA
Sbjct: 2477 PEAVVVSGAETEVEHVAATLGAQGRRVKRLTVSHA 2511


>tr|B0KTI2|B0KTI2_PSEPG Cation efflux protein OS=Pseudomonas putida
(strain GB-1) GN=PputGB1_4191 PE=4 SV=1
Length = 319

Score = 32.7 bits (73), Expect = 9.3
Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 5/97 (5%)
Frame = +2

Query: 140 WEVSLK*CLCLLTAYSAGFHPCKHKPIQSCCMQNTNPFTKPAWLIVLCFILRPFHDSVVR 319
W +S LL A+ G+ +Q ++ +P+ PA L ++C ++ P SVVR
Sbjct: 169 WVMSASITAALLIAFCFGY------AVQGTSLEWVSPYIDPAVLALVCLVIVPLPLSVVR 222

Query: 320 KA*TSASGTFTMTSSGMV*N-----KSDISRHILQYF 415
+A S F +T + + K+ ++RH LQ +
Sbjct: 223 QA---LSEIFLVTPGDLKLHVDEVAKAFVARHGLQSY 256


>tr|A3T368|A3T368_9RHOB Putative uncharacterized protein
OS=Sulfitobacter sp. NAS-14.1 GN=NAS141_02471 PE=4 SV=1
Length = 66

Score = 32.7 bits (73), Expect = 9.3
Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
Frame = -3

Query: 376 LDHTGGSHRKCPRCRGSG-LPDNAIMKWTKNEAQDDQPCWFCEGIG 242
+ TG + R+CP C GSG +PD K + CW C G G
Sbjct: 1 MKETGTAMRECPVCDGSGMMPDALCEVLHKPALKGTVQCWTCYGEG 46