BP911770
Clone id YMU001_000009_A04
Library
Length 312
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000009_A04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TAAATCCCTCTCAACTAGTGGGACATAATGCAAGAAGTTGAGGCCATGATATATCAGAGC
CCTTATCGCTCATGTCTTCCAAGAAGTTGTATGGAGCCATACCATGTCCAAGAGGAAAGT
CTTGGAGGTTGATACGACGTTGCGTCCTCTTGGTTTCCTTGGTCTCCTTTGCCTTCTTTT
CTCGTCCATGGTCACTTTATGACGTAACTTCTTCTTTCTCCTTACCTTTTTCTCGGCCAC
ACTTAATGCCATTTGCTTCCATGTGAGACACTTTAGAATTTGTCACCTCTACCACATGCA
CATTTGGATCTG
■■Homology search results ■■ -
sp_hit_id Q9HCN3
Definition sp|Q9HCN3|TMEM8_HUMAN Transmembrane protein 8 OS=Homo sapiens
Align length 30
Score (bit) 29.3
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911770|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_A04.
(312 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9HCN3|TMEM8_HUMAN Transmembrane protein 8 OS=Homo sapiens GN... 29 6.4

>sp|Q9HCN3|TMEM8_HUMAN Transmembrane protein 8 OS=Homo sapiens
GN=TMEM8 PE=1 SV=2
Length = 771

Score = 29.3 bits (64), Expect = 6.4
Identities = 13/30 (43%), Positives = 18/30 (60%)
Frame = -2

Query: 173 GKGDQGNQEDATSYQPPRLSSWTWYGSIQL 84
GK + G + S P RLS ++WYGS +L
Sbjct: 38 GKSEVGLVSEHFSQAPQRLSFYSWYGSARL 67


tr_hit_id A8XDX8
Definition tr|A8XDX8|A8XDX8_CAEBR Putative uncharacterized protein OS=Caenorhabditis briggsae
Align length 40
Score (bit) 33.5
E-value 5.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911770|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_A04.
(312 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8XDX8|A8XDX8_CAEBR Putative uncharacterized protein OS=Caeno... 33 5.5

>tr|A8XDX8|A8XDX8_CAEBR Putative uncharacterized protein
OS=Caenorhabditis briggsae GN=CBG11699 PE=4 SV=2
Length = 365

Score = 33.5 bits (75), Expect = 5.5
Identities = 16/40 (40%), Positives = 24/40 (60%)
Frame = +3

Query: 120 SWRLIRRCVLLVSLVSFAFFSRPWSLYDVTSSFSLPFSRP 239
+WRL R+C+++ LV FAF L +++S F PF P
Sbjct: 2 AWRLKRKCIIISILVLFAFL---LFLAEISSDFRPPFKNP 38