BP911781
Clone id YMU001_000009_B03
Library
Length 524
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000009_B03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGGATCAATCAATCATTATTCCTCTTCATCTGCCTCATCCTCATCCTCCCCACTGAAGTT
TGGAATCCCATTCATAAGATCATCCTTGGAGTATACCTTCATCCCAGGTGCTCCAGGCAT
GTCACTCATTGATTTCATTATCCTCTCTATTTCGGCATCTTGTGATGACTTTACCATGAA
AGCCTCACCAGGTACCCTATCCTTAGGTACGGAAGGTATCTTGCCACGGCAAGCTTTACT
AAGATCTTTGCAAAGATAATTTGATAGCTCATCCACAGATACAGCCCCTTTATACATAAA
CTCTGCAATATCTGTATCATGATAGCCTATAACCTCTTGGCAAGCCTTCTCAATGGTCTT
GCACTCCGTTTTGCATTCTCCTTCCTCCTCTTGTCGAACTAGCGCCAATGTGTCTCCTTG
TTCGACAATATCTTCATACAAAATCCATTCACCCTCGAATTTTTTCAAATTGCAAATATT
GTCAGCCAATTCTATAATTTGAAACTCTGACACCTGCTTAGGAG
■■Homology search results ■■ -
sp_hit_id Q561R8
Definition sp|Q561R8|FA26F_RAT Protein FAM26F OS=Rattus norvegicus
Align length 57
Score (bit) 33.1
E-value 0.82
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911781|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_B03.
(524 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q561R8|FA26F_RAT Protein FAM26F OS=Rattus norvegicus GN=Fam26... 33 0.82
sp|Q8VZC7|DRL36_ARATH Probable disease resistance protein At5g45... 30 5.3
sp|Q41107|INO1_PHAVU Inositol-3-phosphate synthase OS=Phaseolus ... 30 7.0

>sp|Q561R8|FA26F_RAT Protein FAM26F OS=Rattus norvegicus GN=Fam26f
PE=2 SV=1
Length = 315

Score = 33.1 bits (74), Expect = 0.82
Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
Frame = -3

Query: 294 YKGAVSVD-ELSNYLCKDLSKACRGKIPSVPKDRVPGEAFMVKSSQDAEIERIMKSM 127
Y+ AVS L++YLCKD + +C K+P VP ++ Q+AE++ I+ +
Sbjct: 125 YQCAVSGSTRLASYLCKDRNHSCIAKLPQVPCNK-----------QEAEMQEILSQL 170


>sp|Q8VZC7|DRL36_ARATH Probable disease resistance protein At5g45510
OS=Arabidopsis thaliana GN=At5g45510 PE=1 SV=1
Length = 1202

Score = 30.4 bits (67), Expect = 5.3
Identities = 13/22 (59%), Positives = 14/22 (63%)
Frame = -3

Query: 483 DNICNLKKFEGEWILYEDIVEQ 418
DN KKFE EW LYE+I Q
Sbjct: 68 DNYIKEKKFEDEWSLYENIASQ 89


>sp|Q41107|INO1_PHAVU Inositol-3-phosphate synthase OS=Phaseolus
vulgaris PE=2 SV=1
Length = 511

Score = 30.0 bits (66), Expect = 7.0
Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 5/60 (8%)
Frame = +2

Query: 62 GIPFIRSSLEYTFIPGAPGMSLIDFIILSISASCDDF-----TMKASPGTLSLGTEGILP 226
GIPFI S ++TF+PG M++ + +++ DDF MK+ G +G GI P
Sbjct: 276 GIPFINGSPQHTFVPGLIDMAIRNNVLI----GGDDFKSGQTKMKSVLGDFLVGA-GIKP 330


tr_hit_id A9P283
Definition tr|A9P283|A9P283_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 156
Score (bit) 187.0
E-value 4.0e-46
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911781|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_B03.
(524 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9P283|A9P283_PICSI Putative uncharacterized protein OS=Picea... 187 4e-46
tr|A7PEB2|A7PEB2_VITVI Chromosome chr11 scaffold_13, whole genom... 187 4e-46
tr|B7FHV2|B7FHV2_MEDTR Putative uncharacterized protein OS=Medic... 185 1e-45
tr|B6TES2|B6TES2_MAIZE Putative uncharacterized protein OS=Zea m... 177 2e-43
tr|B4F845|B4F845_MAIZE Putative uncharacterized protein OS=Zea m... 177 2e-43
tr|Q9SU93|Q9SU93_ARATH Putative uncharacterized protein T16L4.30... 177 3e-43
tr|Q8LER2|Q8LER2_ARATH Putative uncharacterized protein OS=Arabi... 177 3e-43
tr|Q5VML4|Q5VML4_ORYSJ Os06g0150400 protein OS=Oryza sativa subs... 172 7e-42
tr|B8B314|B8B314_ORYSI Putative uncharacterized protein OS=Oryza... 172 7e-42
tr|A9RJH2|A9RJH2_PHYPA Predicted protein OS=Physcomitrella paten... 167 4e-40
tr|A3B8F6|A3B8F6_ORYSJ Putative uncharacterized protein OS=Oryza... 138 2e-31
tr|A7S7Q9|A7S7Q9_NEMVE Predicted protein (Fragment) OS=Nematoste... 108 1e-22
tr|A4RS66|A4RS66_OSTLU Predicted protein (Fragment) OS=Ostreococ... 103 4e-21
tr|Q01FF7|Q01FF7_OSTTA Homology to unknown gene OS=Ostreococcus ... 101 3e-20
tr|A2Y9F2|A2Y9F2_ORYSI Putative uncharacterized protein OS=Oryza... 95 2e-18
tr|A7T4R4|A7T4R4_NEMVE Predicted protein (Fragment) OS=Nematoste... 88 3e-16
tr|A8J2L8|A8J2L8_CHLRE Predicted protein OS=Chlamydomonas reinha... 66 9e-10
tr|A5BQU0|A5BQU0_VITVI Putative uncharacterized protein (Fragmen... 42 0.024
tr|A9S4M5|A9S4M5_PHYPA Predicted protein OS=Physcomitrella paten... 38 0.27
tr|A9NKI3|A9NKI3_PICSI Putative uncharacterized protein OS=Picea... 38 0.35
tr|A7QPE0|A7QPE0_VITVI Chromosome chr18 scaffold_137, whole geno... 36 1.0
tr|A4RSI6|A4RSI6_OSTLU Predicted protein (Fragment) OS=Ostreococ... 36 1.3
tr|Q4P712|Q4P712_USTMA Putative uncharacterized protein OS=Ustil... 35 3.0
tr|Q4RUK7|Q4RUK7_TETNG Chromosome 8 SCAF14994, whole genome shot... 33 6.6
tr|Q03PQ4|Q03PQ4_LACBA ATP-dependent DNA helicase RecQ OS=Lactob... 33 6.6
tr|B6T6D7|B6T6D7_MAIZE MIR-interacting saposin-like protein OS=Z... 33 6.6

>tr|A9P283|A9P283_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 314

Score = 187 bits (474), Expect = 4e-46
Identities = 92/156 (58%), Positives = 114/156 (73%)
Frame = -3

Query: 522 PKQVSEFQIIELADNICNLKKFEGEWILYEDIVEQGDTLALVRQXXXXXXXXXXXXXXKA 343
PK++SE+QIIE+A+NICNLKK EG+W+L+ DIVE GD L LV Q +
Sbjct: 66 PKRLSEYQIIEVAENICNLKKEEGDWLLHLDIVEDGDKLKLVEQEQEGDCNAECKTIERT 125

Query: 342 CQEVIGYHDTDIAEFMYKGAVSVDELSNYLCKDLSKACRGKIPSVPKDRVPGEAFMVKSS 163
CQEVIGYHDTD+AEF++K L +LC DLS+AC K P VPKDR PGE F+ KSS
Sbjct: 126 CQEVIGYHDTDVAEFLFKSEPQSSSLLKFLCNDLSRACSVKPPPVPKDRTPGEPFVPKSS 185

Query: 162 QDAEIERIMKSMSDMPGAPGMKVYSKDDLMNGIPNF 55
++AE+E+IM+SMS MPGA MK+YSKDDLMN +PNF
Sbjct: 186 KEAEMEKIMRSMSGMPGASNMKMYSKDDLMN-MPNF 220


>tr|A7PEB2|A7PEB2_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016597001
PE=4 SV=1
Length = 299

Score = 187 bits (474), Expect = 4e-46
Identities = 89/151 (58%), Positives = 111/151 (73%)
Frame = -3

Query: 522 PKQVSEFQIIELADNICNLKKFEGEWILYEDIVEQGDTLALVRQXXXXXXXXXXXXXXKA 343
PK++SEF+IIE+++N+CNLKK E +WIL DIVEQGD L LV Q +A
Sbjct: 64 PKKISEFEIIEISENVCNLKKEEADWILRIDIVEQGDKLKLVEQDSEGQCNSECKTIERA 123

Query: 342 CQEVIGYHDTDIAEFMYKGAVSVDELSNYLCKDLSKACRGKIPSVPKDRVPGEAFMVKSS 163
CQEV+GY DTD AE++YK +D L NYLCKDL+KAC P VPKDR PGE F+ KS
Sbjct: 124 CQEVMGYSDTDAAEYVYKNKPQIDSLVNYLCKDLTKACSASPPPVPKDRTPGEPFVPKSL 183

Query: 162 QDAEIERIMKSMSDMPGAPGMKVYSKDDLMN 70
++AE+E+IMKSM MPGAPGMK+YS++DLMN
Sbjct: 184 KEAEMEKIMKSMEGMPGAPGMKMYSREDLMN 214


>tr|B7FHV2|B7FHV2_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 301

Score = 185 bits (469), Expect = 1e-45
Identities = 86/150 (57%), Positives = 110/150 (73%)
Frame = -3

Query: 522 PKQVSEFQIIELADNICNLKKFEGEWILYEDIVEQGDTLALVRQXXXXXXXXXXXXXXKA 343
PK++SE+QIIE+A+N+CNLKK E +WIL DIVE+ D L L +A
Sbjct: 64 PKKISEYQIIEIAENVCNLKKVEADWILRIDIVEKADRLELEEHDSEGQCNSEYKTVERA 123

Query: 342 CQEVIGYHDTDIAEFMYKGAVSVDELSNYLCKDLSKACRGKIPSVPKDRVPGEAFMVKSS 163
CQEV+GY DTD+AE++Y +D L+NYLCKDLSKAC K P VPKDR PGE F+ KSS
Sbjct: 124 CQEVMGYSDTDVAEYLYSSKPDIDSLTNYLCKDLSKACNTKPPPVPKDRTPGEPFVAKSS 183

Query: 162 QDAEIERIMKSMSDMPGAPGMKVYSKDDLM 73
++AE+E+++KSM MPGAPGMK+YS+DDLM
Sbjct: 184 KEAEMEKLLKSMEGMPGAPGMKMYSRDDLM 213


>tr|B6TES2|B6TES2_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 303

Score = 177 bits (450), Expect = 2e-43
Identities = 88/149 (59%), Positives = 108/149 (72%)
Frame = -3

Query: 519 KQVSEFQIIELADNICNLKKFEGEWILYEDIVEQGDTLALVRQXXXXXXXXXXXXXXKAC 340
K+V E +IIE+A+N+CNLKK E +W+L DIVE+GD L LV Q +AC
Sbjct: 70 KKVPEIEIIEVAENVCNLKKQEADWMLRIDIVEKGDKLELVEQDEEGHCNAECKTIERAC 129

Query: 339 QEVIGYHDTDIAEFMYKGAVSVDELSNYLCKDLSKACRGKIPSVPKDRVPGEAFMVKSSQ 160
QEVIGY DTD+AEF+YK SVD+L +LCKDLSKAC P VPKDRVPGE F K S+
Sbjct: 130 QEVIGYADTDVAEFVYKNNPSVDQLMKFLCKDLSKACAKDPPPVPKDRVPGEPFARKPSK 189

Query: 159 DAEIERIMKSMSDMPGAPGMKVYSKDDLM 73
DAE+E+I++SM MPGAP MK+YS+DDLM
Sbjct: 190 DAEMEKILRSMEGMPGAPSMKMYSRDDLM 218


>tr|B4F845|B4F845_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 303

Score = 177 bits (450), Expect = 2e-43
Identities = 88/149 (59%), Positives = 108/149 (72%)
Frame = -3

Query: 519 KQVSEFQIIELADNICNLKKFEGEWILYEDIVEQGDTLALVRQXXXXXXXXXXXXXXKAC 340
K+V E +IIE+A+N+CNLKK E +W+L DIVE+GD L LV Q +AC
Sbjct: 70 KKVPEIEIIEVAENVCNLKKQEADWMLRIDIVEKGDKLELVEQDEEGHCNAECKTIERAC 129

Query: 339 QEVIGYHDTDIAEFMYKGAVSVDELSNYLCKDLSKACRGKIPSVPKDRVPGEAFMVKSSQ 160
QEVIGY DTD+AEF+YK SVD+L +LCKDLSKAC P VPKDRVPGE F K S+
Sbjct: 130 QEVIGYADTDVAEFVYKNNPSVDQLMKFLCKDLSKACAKDPPPVPKDRVPGEPFARKPSK 189

Query: 159 DAEIERIMKSMSDMPGAPGMKVYSKDDLM 73
DAE+E+I++SM MPGAP MK+YS+DDLM
Sbjct: 190 DAEMEKILRSMEGMPGAPSMKMYSRDDLM 218


>tr|Q9SU93|Q9SU93_ARATH Putative uncharacterized protein T16L4.30
(Putative uncharacterized protein AT4g29520)
OS=Arabidopsis thaliana GN=AT4g29520 PE=2 SV=1
Length = 306

Score = 177 bits (449), Expect = 3e-43
Identities = 83/152 (54%), Positives = 110/152 (72%)
Frame = -3

Query: 522 PKQVSEFQIIELADNICNLKKFEGEWILYEDIVEQGDTLALVRQXXXXXXXXXXXXXXKA 343
PK++SE++IIE+A+N+CNLKK E +W+L DIVE+GD L LV Q A
Sbjct: 68 PKKISEYEIIEIAENVCNLKKEEADWMLKIDIVEKGDNLVLVEQQEEGMCNSKCKTIENA 127

Query: 342 CQEVIGYHDTDIAEFMYKGAVSVDELSNYLCKDLSKACRGKIPSVPKDRVPGEAFMVKSS 163
CQ+VIGY DTD+AE++YK + L N+LCKDL+ AC K P VPKDRVPGE F+ K S
Sbjct: 128 CQKVIGYSDTDVAEYIYKSKPDLVSLVNHLCKDLTDACSKKPPPVPKDRVPGEPFVAKPS 187

Query: 162 QDAEIERIMKSMSDMPGAPGMKVYSKDDLMNG 67
+DAE+++I++SM MPGAPGMKVYS++D+ G
Sbjct: 188 KDAEMDKILRSMQGMPGAPGMKVYSREDIEKG 219


>tr|Q8LER2|Q8LER2_ARATH Putative uncharacterized protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 303

Score = 177 bits (449), Expect = 3e-43
Identities = 83/152 (54%), Positives = 110/152 (72%)
Frame = -3

Query: 522 PKQVSEFQIIELADNICNLKKFEGEWILYEDIVEQGDTLALVRQXXXXXXXXXXXXXXKA 343
PK++SE++IIE+A+N+CNLKK E +W+L DIVE+GD L LV Q A
Sbjct: 65 PKKISEYEIIEIAENVCNLKKEEADWMLKIDIVEKGDNLVLVEQQEEGMCNSKCKTIENA 124

Query: 342 CQEVIGYHDTDIAEFMYKGAVSVDELSNYLCKDLSKACRGKIPSVPKDRVPGEAFMVKSS 163
CQ+VIGY DTD+AE++YK + L N+LCKDL+ AC K P VPKDRVPGE F+ K S
Sbjct: 125 CQKVIGYSDTDVAEYIYKSKPDLVSLVNHLCKDLTDACSKKPPPVPKDRVPGEPFVAKPS 184

Query: 162 QDAEIERIMKSMSDMPGAPGMKVYSKDDLMNG 67
+DAE+++I++SM MPGAPGMKVYS++D+ G
Sbjct: 185 KDAEMDKILRSMQGMPGAPGMKVYSREDIEKG 216


>tr|Q5VML4|Q5VML4_ORYSJ Os06g0150400 protein OS=Oryza sativa subsp.
japonica GN=P0529C07.1 PE=4 SV=1
Length = 306

Score = 172 bits (437), Expect = 7e-42
Identities = 85/149 (57%), Positives = 107/149 (71%)
Frame = -3

Query: 519 KQVSEFQIIELADNICNLKKFEGEWILYEDIVEQGDTLALVRQXXXXXXXXXXXXXXKAC 340
K+V E +IIE+A+N+CNLKK E +W+L DIVE+GD L LV Q +AC
Sbjct: 75 KKVPEIEIIEIAENVCNLKKQEADWMLKIDIVEKGDKLELVEQDEEGHCNAECKTIERAC 134

Query: 339 QEVIGYHDTDIAEFMYKGAVSVDELSNYLCKDLSKACRGKIPSVPKDRVPGEAFMVKSSQ 160
QEV+GY DTD+AEF+YK S D+L +LCKDLS+AC P VPKDRVPGE F K S+
Sbjct: 135 QEVMGYADTDVAEFVYKKKPSADQLVKFLCKDLSEACVVDPPPVPKDRVPGEPFAAKPSK 194

Query: 159 DAEIERIMKSMSDMPGAPGMKVYSKDDLM 73
DAE++RI+KSM +PGAP MK+YS+DDLM
Sbjct: 195 DAEMDRILKSMEGIPGAPSMKMYSRDDLM 223


>tr|B8B314|B8B314_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_21695 PE=4 SV=1
Length = 306

Score = 172 bits (437), Expect = 7e-42
Identities = 85/149 (57%), Positives = 107/149 (71%)
Frame = -3

Query: 519 KQVSEFQIIELADNICNLKKFEGEWILYEDIVEQGDTLALVRQXXXXXXXXXXXXXXKAC 340
K+V E +IIE+A+N+CNLKK E +W+L DIVE+GD L LV Q +AC
Sbjct: 75 KKVPEIEIIEIAENVCNLKKQEADWMLKIDIVEKGDKLELVEQDEEGHCNAECKTIERAC 134

Query: 339 QEVIGYHDTDIAEFMYKGAVSVDELSNYLCKDLSKACRGKIPSVPKDRVPGEAFMVKSSQ 160
QEV+GY DTD+AEF+YK S D+L +LCKDLS+AC P VPKDRVPGE F K S+
Sbjct: 135 QEVMGYADTDVAEFVYKKKPSADQLVKFLCKDLSEACVVDPPPVPKDRVPGEPFAAKPSK 194

Query: 159 DAEIERIMKSMSDMPGAPGMKVYSKDDLM 73
DAE++RI+KSM +PGAP MK+YS+DDLM
Sbjct: 195 DAEMDRILKSMEGIPGAPSMKMYSRDDLM 223


>tr|A9RJH2|A9RJH2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_115335 PE=4 SV=1
Length = 306

Score = 167 bits (422), Expect = 4e-40
Identities = 77/149 (51%), Positives = 110/149 (73%)
Frame = -3

Query: 522 PKQVSEFQIIELADNICNLKKFEGEWILYEDIVEQGDTLALVRQXXXXXXXXXXXXXXKA 343
P++++E +II++A+NICN+KK E +WIL DIVE+GD L LV Q +A
Sbjct: 61 PRKITELEIIDVAENICNMKKEESDWILKLDIVEKGDKLQLVEQQEEGVCNTECKTIERA 120

Query: 342 CQEVIGYHDTDIAEFMYKGAVSVDELSNYLCKDLSKACRGKIPSVPKDRVPGEAFMVKSS 163
C+EV+G HDTD+AE++YK + L+ LCKDLSKAC GK P VPKDRVPGEAF K
Sbjct: 121 CREVMGDHDTDLAEYLYKAGATRAGLTKLLCKDLSKACVGKTPRVPKDRVPGEAFTPKGG 180

Query: 162 QDAEIERIMKSMSDMPGAPGMKVYSKDDL 76
++AE+E++M+S++D+PGAP MK++S+++L
Sbjct: 181 KEAEMEKLMRSLNDVPGAPSMKMFSREEL 209