BP911785
Clone id YMU001_000009_B08
Library
Length 475
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000009_B08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CCCGGTGCTTTTTTGGTTTTTATTTCTCTCCCCAACCGGCCATTTCACCTGTTCATTGCA
TGTCGTACTGGCAATGTTGATCACACAGCCCAGCAATTGATGTCCTGCCTGATGGTCAAC
AGATTACGTGCAAGCTTCTGAGTAGATTTGACATCAAGATCCGATATCGAAGTTCTACTG
AGAGTGGTGAAAAGCTTGTAATGGATAATGTGGTCTACTGGGAGGCAAGACAGGTGCTAG
CTGCACTGCTACTCAGGGTTGGTTAGCTTTATCTGCTTGGTTTGGGCATATGAGCAATGG
AACTCCTCATCTGTTAGAGAATTGTCCACAACTAATGTAAAGAGCGATATATCATTGATA
ACTGATCTTGTTGGACAAATTGCTAAATAATGTCTTCAGGGCAACAGCAACAGCTGTTGC
GCTCATATTGAGACGTGCAATTTTAAGGAAGACTTCTTTCTGACAACTTTCATGT
■■Homology search results ■■ -
sp_hit_id Q3SRV7
Definition sp|Q3SRV7|RISB_NITWN 6,7-dimethyl-8-ribityllumazine synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391)
Align length 49
Score (bit) 31.6
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911785|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_B08.
(475 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q3SRV7|RISB_NITWN 6,7-dimethyl-8-ribityllumazine synthase OS=... 32 1.9
sp|Q1QMB5|RISB_NITHX 6,7-dimethyl-8-ribityllumazine synthase OS=... 31 2.4
sp|Q58836|Y1441_METJA Uncharacterized protein MJ1441 OS=Methanoc... 30 7.1
sp|P61726|RISB1_RHOPA 6,7-dimethyl-8-ribityllumazine synthase 1 ... 30 7.1

>sp|Q3SRV7|RISB_NITWN 6,7-dimethyl-8-ribityllumazine synthase
OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391)
GN=ribH PE=3 SV=1
Length = 163

Score = 31.6 bits (70), Expect = 1.9
Identities = 14/49 (28%), Positives = 24/49 (48%)
Frame = -3

Query: 233 LSCLPVDHIIHYKLFTTLSRTSISDLDVKSTQKLARNLLTIRQDINCWA 87
L C+ IH+++ + S ++ DL VK L ++T+ D WA
Sbjct: 85 LGCVVRGDTIHFEIVSMESARALMDLSVKRGVALGNGIITVDTDAQAWA 133


>sp|Q1QMB5|RISB_NITHX 6,7-dimethyl-8-ribityllumazine synthase
OS=Nitrobacter hamburgensis (strain X14 / DSM 10229)
GN=ribH PE=3 SV=1
Length = 163

Score = 31.2 bits (69), Expect = 2.4
Identities = 13/49 (26%), Positives = 24/49 (48%)
Frame = -3

Query: 233 LSCLPVDHIIHYKLFTTLSRTSISDLDVKSTQKLARNLLTIRQDINCWA 87
L C+ IH+++ + S ++ DL V+ L ++T+ D WA
Sbjct: 85 LGCVVRGDTIHFEIVSMESSRALMDLSVQRRVPLGNGIITVNTDAQAWA 133


>sp|Q58836|Y1441_METJA Uncharacterized protein MJ1441
OS=Methanocaldococcus jannaschii GN=MJ1441 PE=3 SV=1
Length = 1226

Score = 29.6 bits (65), Expect = 7.1
Identities = 11/29 (37%), Positives = 18/29 (62%)
Frame = -3

Query: 176 RTSISDLDVKSTQKLARNLLTIRQDINCW 90
RTS D+D++ +K N++ + QD N W
Sbjct: 58 RTSSDDIDLEKIKKFNENVIVVAQDPNFW 86


>sp|P61726|RISB1_RHOPA 6,7-dimethyl-8-ribityllumazine synthase 1
OS=Rhodopseudomonas palustris GN=ribH1 PE=3 SV=1
Length = 163

Score = 29.6 bits (65), Expect = 7.1
Identities = 13/49 (26%), Positives = 23/49 (46%)
Frame = -3

Query: 233 LSCLPVDHIIHYKLFTTLSRTSISDLDVKSTQKLARNLLTIRQDINCWA 87
L C+ IH+++ + S ++ DL V L ++T+ D WA
Sbjct: 85 LGCVVRGETIHFEIVSMESARALMDLSVARKFPLGNGIITVNTDEQAWA 133


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911785|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_B08.
(475 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******