BP911791
Clone id YMU001_000009_C02
Library
Length 582
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000009_C02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCTTCTCTGCCTTCTCCCTCATGTGGGACTGCTCCTTGCATTGGCTCGTAAGTAGCAGTA
TCTGTTCTTGACCGCCCAGCTCACTCTTTCCTTTCTGCTTAACCAAGTGCTCTACTTCTT
GCAGTTTTCGCTCAAGGACATCTCTTTGAGAGCGCTCTACTTCCAATCGTTTGGTCAGCT
CCATCACCTCTTGTTGATGTCTCTGCTTGCGGTCGTCAAGCTCTTTCTGATGCCTTGCTC
TTTCACTCTGCATCTGCTTCTCTTTTTGAACATGCAAAGTCTGAGTGTTCTCTTTGAGCT
CCTTCTCCAGCTTTTCTCGAAGAGATCGTTCTTGCTCTAGTTTGTGAGCAGTTTCTGCAT
GCTCTTTCTGGAAACGAAACCTTTCTGCTGCCATTTCCTCTAGTGTTGTTGCCAATTTCT
TCTCTGCTTCTGTAACAGAGCGTTGAGCTTCCTGGATTTTTGCTTCCATTTCCTCTTCAG
CATCAAAAACTGCCTGACTCTGCCGCTCATTCTCTGCAACCAGTCTGTCAAGATCGGTCT
CAAGCTTTCTACACAGACTCTTGTAGTCAAATTCTTCTCTCA
■■Homology search results ■■ -
sp_hit_id Q9SV36
Definition sp|Q9SV36|ARK1_ARATH Armadillo repeat-containing kinesin-like protein 1 OS=Arabidopsis thaliana
Align length 166
Score (bit) 84.3
E-value 4.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911791|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_C02.
(582 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SV36|ARK1_ARATH Armadillo repeat-containing kinesin-like pr... 84 4e-16
sp|Q9FZ06|ARK3_ARATH Armadillo repeat-containing kinesin-like pr... 81 3e-15
sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like pr... 72 3e-12
sp|Q9LPC6|ARK2_ARATH Armadillo repeat-containing kinesin-like pr... 65 2e-10
sp|Q0DV28|ARK1_ORYSJ Armadillo repeat-containing kinesin-like pr... 63 1e-09
sp|A6RW62|NST1_BOTFB Stress response protein nst1 OS=Botryotinia... 54 7e-07
sp|Q6CBW0|NST1_YARLI Stress response protein NST1 OS=Yarrowia li... 50 6e-06
sp|A7EMM3|NST1_SCLS1 Stress response protein nst1 OS=Sclerotinia... 50 6e-06
sp|Q5RG44|K1211_DANRE Uncharacterized protein KIAA1211 homolog O... 48 4e-05
sp|Q4PBP6|NST1_USTMA Stress response protein NST1 OS=Ustilago ma... 47 9e-05
sp|A6NEY3|GG6L3_HUMAN Putative golgin subfamily A member 6-like ... 47 9e-05
sp|Q54Y06|Y8487_DICDI Probable cyclin-dependent serine/threonine... 46 2e-04
sp|O13024|INCEA_XENLA Inner centromere protein A OS=Xenopus laev... 46 2e-04
sp|P37709|TRHY_RABIT Trichohyalin OS=Oryctolagus cuniculus GN=TC... 45 3e-04
sp|Q1E1H4|NST1_COCIM Stress response protein NST1 OS=Coccidioide... 45 3e-04
sp|A2AJI0|MA7D1_MOUSE MAP7 domain-containing protein 1 OS=Mus mu... 45 3e-04
sp|Q9QXS1|PLEC1_MOUSE Plectin-1 OS=Mus musculus GN=Plec1 PE=1 SV=2 45 3e-04
sp|P12957|CALD1_CHICK Caldesmon OS=Gallus gallus GN=CALD1 PE=1 SV=2 45 3e-04
sp|A7TR75|NST1_VANPO Stress response protein NST1 OS=Vanderwalto... 44 4e-04
sp|Q0UJJ7|NST1_PHANO Stress response protein NST1 OS=Phaeosphaer... 44 4e-04
sp|Q28641|MYH4_RABIT Myosin-4 OS=Oryctolagus cuniculus GN=MYH4 P... 44 4e-04
sp|O08638|MYH11_MOUSE Myosin-11 OS=Mus musculus GN=Myh11 PE=1 SV=1 44 4e-04
sp|Q9JHZ4|GRAP1_RAT GRIP1-associated protein 1 OS=Rattus norvegi... 44 4e-04
sp|Q4V328|GRAP1_HUMAN GRIP1-associated protein 1 OS=Homo sapiens... 44 4e-04
sp|P22793|TRHY_SHEEP Trichohyalin OS=Ovis aries GN=TCHH PE=2 SV=2 44 6e-04
sp|Q5U236|PERQ2_XENLA PERQ amino acid-rich with GYF domain-conta... 44 6e-04
sp|Q076A6|MYH1_CANFA Myosin-1 OS=Canis familiaris GN=MYH1 PE=3 SV=2 44 6e-04
sp|Q6URW6|MYH14_MOUSE Myosin-14 OS=Mus musculus GN=Myh14 PE=2 SV=1 44 6e-04
sp|Q8MJV0|MYH1_HORSE Myosin-1 OS=Equus caballus GN=MYH1 PE=2 SV=1 43 0.001
sp|P35748|MYH11_RABIT Myosin-11 OS=Oryctolagus cuniculus GN=MYH1... 43 0.001

>sp|Q9SV36|ARK1_ARATH Armadillo repeat-containing kinesin-like
protein 1 OS=Arabidopsis thaliana GN=ARK1 PE=1 SV=2
Length = 1051

Score = 84.3 bits (207), Expect = 4e-16
Identities = 49/166 (29%), Positives = 88/166 (53%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+EEFDY+SLCRKLET +D L AE ERQ++ + E+E +++E + S EAEK T
Sbjct: 448 KEEFDYESLCRKLETQVDHLTAEVERQNKLRNSEKHELEKRLRECENSFAEAEKNAVTRS 507

Query: 400 EEMAAERFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERARHQKE 221
+ + E R + E + ++ KQ Q E + ++ +
Sbjct: 508 KFLEKENTRLELSMKELLKDLQLQKDQCDLMHDKAI--QLEMKLKNTKQQQLENSAYEAK 565

Query: 220 LDDRKQRHQQEVMELTKRLEVERSQRDVLERKLQEVEHLVKQKGKS 83
L D Q +++++ EL +R+E E+++ E +L E+++++ ++ KS
Sbjct: 566 LADTSQVYEKKIAELVQRVEDEQARSTNAEHQLTEMKNILSKQQKS 611



Score = 32.0 bits (71), Expect = 2.3
Identities = 39/191 (20%), Positives = 78/191 (40%), Gaps = 22/191 (11%)
Frame = -3

Query: 508 ERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLAT---TLEEMAAERFRFQKEHAETAHXX 338
E++ + E+ +A+ A+ +TE + L+ ++ E +++Q+E AET H
Sbjct: 574 EKKIAELVQRVEDEQARSTNAEHQLTEMKNILSKQQKSIHEQEKGNYQYQRELAETTH-- 631

Query: 337 XXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERARHQKELDDRKQ------------RHQ 194
++ + +K+++ E AR D +Q +
Sbjct: 632 ----------------TYESKIAELQKKLEGENARSNAAEDQLRQMKRLISDRQVISQEN 675

Query: 193 QEVMELTKRLE----VERSQRDVLERKLQEVEHLVKQK---GKSELGGQEQILLLTSQCK 35
+E EL +LE + S D L+ + + L++QK G+ +E++LL Q K
Sbjct: 676 EEANELKIKLEELSQMYESTVDELQTVKLDYDDLLQQKEKLGEEVRDMKERLLLEEKQRK 735

Query: 34 EQSHMREKAEK 2
+ K +K
Sbjct: 736 QMESELSKLKK 746



Score = 32.0 bits (71), Expect = 2.3
Identities = 25/67 (37%), Positives = 34/67 (50%)
Frame = -3

Query: 268 QKEKQMQSERARHQKELDDRKQRHQQEVMELTKRLEVERSQRDVLERKLQEVEHLVKQKG 89
QKEK + R ++ L + KQR Q E EL+K + R +V+E K E L KG
Sbjct: 712 QKEKLGEEVRDMKERLLLEEKQRKQME-SELSKLKKNLRESENVVEEKRYMKEDL--SKG 768

Query: 88 KSELGGQ 68
+E G Q
Sbjct: 769 SAESGAQ 775


>sp|Q9FZ06|ARK3_ARATH Armadillo repeat-containing kinesin-like
protein 3 OS=Arabidopsis thaliana GN=ARK3 PE=1 SV=1
Length = 919

Score = 81.3 bits (199), Expect = 3e-15
Identities = 58/200 (29%), Positives = 97/200 (48%), Gaps = 8/200 (4%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+EEFDYKSL R+LE LD L+ ENERQ +A D E+E EA ++EAEK+ A L
Sbjct: 419 KEEFDYKSLSRRLEVQLDNLIEENERQQKAFVD---EIERITVEAHNQISEAEKRYANAL 475

Query: 400 EEMAAERFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERAR--HQ 227
E+ E+ R+Q ++ E+ + + + +K++ +ER +
Sbjct: 476 ED---EKLRYQNDYMES------------------IKKLEENWSKNQKKLAAERLALGEK 514

Query: 226 KELDDRKQRHQ------QEVMELTKRLEVERSQRDVLERKLQEVEHLVKQKGKSELGGQE 65
LD ++ +EV EL K L+ E + E ++ ++H + + K E G
Sbjct: 515 NGLDITSNGNRSIAPALEEVSELKKLLQKEAQSKMAAEEEVNRLKHQLNEFKKVEASGNS 574

Query: 64 QILLLTSQCKEQSHMREKAE 5
+I+ L + ++ +EK E
Sbjct: 575 EIMRLHKMLENETQQKEKLE 594


>sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like
protein 2 OS=Oryza sativa subsp. japonica
GN=Os06g0137100 PE=2 SV=1
Length = 891

Score = 71.6 bits (174), Expect = 3e-12
Identities = 51/169 (30%), Positives = 86/169 (50%), Gaps = 16/169 (9%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+EEFDYKSLCR+L+ +LD+L+AENERQ + FD +E+E EAQ VTEAE++ +L
Sbjct: 407 KEEFDYKSLCRRLDIELDKLIAENERQ-RKYFD--DEIERITAEAQLRVTEAEREYKISL 463

Query: 400 EEMAAERFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHV---QKEKQMQSERARH 230
E E+ ++ +E+ ++ + T+ + + +Q+E+
Sbjct: 464 EN---EKAKYHQEYLDSIKILEEKWKIHQQSPKKLIKETEPTSSEVGEVQNLLQNEKVLR 520

Query: 229 QKELDDRKQRHQQ-------------EVMELTKRLEVERSQRDVLERKL 122
Q D+ Q EV++L K L+ E SQ++ L+ ++
Sbjct: 521 QSAEDEANDLKNQVLHWKKMEAAATAEVVKLRKMLDTEASQKEKLDEEI 569


>sp|Q9LPC6|ARK2_ARATH Armadillo repeat-containing kinesin-like
protein 2 OS=Arabidopsis thaliana GN=ARK2 PE=1 SV=2
Length = 894

Score = 65.1 bits (157), Expect = 2e-10
Identities = 45/180 (25%), Positives = 89/180 (49%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+EEFDYKSL +KLE LD+++AENERQ +A ++++E ++AQ ++E EK A L
Sbjct: 409 KEEFDYKSLSKKLEVQLDKVIAENERQLKAF---DDDVERINRQAQNRISEVEKNFAEAL 465

Query: 400 EEMAAERFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERARHQKE 221
E+ E+ + Q E+ E+ N + V + + + E
Sbjct: 466 EK---EKLKCQMEYMESVKKLEEKLISNQRNHENGKRNGEVNGVVTASEFTRLKESLENE 522

Query: 220 LDDRKQRHQQEVMELTKRLEVERSQRDVLERKLQEVEHLVKQKGKSELGGQEQILLLTSQ 41
+ RK ++EV ++ + ++ + + + ++ L++ + + +E++ +L SQ
Sbjct: 523 MKLRKSA-EEEVSKVKSQSTLKTRSGEGEDAGITRLQKLLEDEALQKKKLEEEVTILRSQ 581


>sp|Q0DV28|ARK1_ORYSJ Armadillo repeat-containing kinesin-like
protein 1 OS=Oryza sativa subsp. japonica
GN=Os03g0152900 PE=2 SV=2
Length = 945

Score = 62.8 bits (151), Expect = 1e-09
Identities = 45/182 (24%), Positives = 90/182 (49%), Gaps = 11/182 (6%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+EE DY+SL +K+E ++D L +E ERQ + + ++E K++E++ S+ + + +
Sbjct: 406 KEEVDYESLYKKVEHEVDHLTSEMERQQKLKNSEKMQLEKKLKESEASLNDLKVTSNMQI 465

Query: 400 EEMAAERFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQ----KEKQMQSERAR 233
E MA E+ + + + + Q +H++ + KQ Q E
Sbjct: 466 ENMAMEKRQLE------STIKRLMLDLEKEKGKNNILSEQIIHLETSLDENKQKQLENIS 519

Query: 232 HQKELDDRKQRHQQEVMELTKRLEVERSQR-------DVLERKLQEVEHLVKQKGKSELG 74
+ L D + H++++ EL K+LE ERS+ +VL+++L + ++ ++ EL
Sbjct: 520 NTNILADTTKSHEKKIRELLKQLEDERSRSASMNDHLNVLQQQLSDAQNYFQKNIACELE 579

Query: 73 GQ 68
Q
Sbjct: 580 KQ 581


>sp|A6RW62|NST1_BOTFB Stress response protein nst1 OS=Botryotinia
fuckeliana (strain B05.10) GN=nst1 PE=3 SV=1
Length = 1168

Score = 53.5 bits (127), Expect = 7e-07
Identities = 54/173 (31%), Positives = 81/173 (46%), Gaps = 4/173 (2%)
Frame = -3

Query: 508 ERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTLEE---MAAERFRFQKEH-AETAHX 341
ERQ + + + EEE A Q+ + +A+KK LE+ MA E+ R E AE A
Sbjct: 486 ERQQKLLEELEEESRADSQKKAKRAKDAQKKKEKLLEKKRAMAEEKARKDAEKAAEEASL 545

Query: 340 XXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERARHQKELDDRKQRHQQEVMELTKRLE 161
EN + QK K + ER R + E KQR QE E ++ E
Sbjct: 546 REIEEKKAEAQRLKREENRKKKEAQK-KADEEERVRKESE----KQRRLQEQRE--RQAE 598

Query: 160 VERSQRDVLERKLQEVEHLVKQKGKSELGGQEQILLLTSQCKEQSHMREKAEK 2
ER QR+ ER+ +E E L +Q ++ ++I ++ +++ H REK EK
Sbjct: 599 QERKQREAKERERKEKEELRRQALEA-----KEIKEKEAKERKEKHEREKREK 646



Score = 38.9 bits (89), Expect = 0.019
Identities = 35/154 (22%), Positives = 67/154 (43%), Gaps = 6/154 (3%)
Frame = -3

Query: 526 RLVAENERQSQAVFDAEE----EMEAKIQEAQRSVTEAEKKLATTLEEMAAERFRFQKEH 359
R +AE + + A AEE E+E K EAQR E +K ++ A E R +KE
Sbjct: 525 RAMAEEKARKDAEKAAEEASLREIEEKKAEAQRLKREENRKKKEA-QKKADEEERVRKES 583

Query: 358 AETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERARH--QKELDDRKQRHQQEV 185
+ + ++E + Q+ A+ +KE +RK++H++E
Sbjct: 584 EKQRRLQEQRERQAEQERKQREAKERERKEKEELRRQALEAKEIKEKEAKERKEKHEREK 643

Query: 184 MELTKRLEVERSQRDVLERKLQEVEHLVKQKGKS 83
E +++ ++ R++ +R+ + Q +S
Sbjct: 644 REKEAKVKADKEARELQKREELSAQQAAVQAAQS 677



Score = 32.3 bits (72), Expect = 1.8
Identities = 35/152 (23%), Positives = 64/152 (42%), Gaps = 4/152 (2%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
RE + K+ ++L+ + +R E ++++ EEE K E QR + E ++ A
Sbjct: 546 REIEEKKAEAQRLKREENRKKKEAQKKAD-----EEERVRKESEKQRRLQEQRERQAEQE 600

Query: 400 EEMAAERFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQ--KEKQMQSERARHQ 227
+ + R +KE E Q L + KEK+ + + +H+
Sbjct: 601 RKQREAKERERKEKEELRR--------------------QALEAKEIKEKEAKERKEKHE 640

Query: 226 KELDDR--KQRHQQEVMELTKRLEVERSQRDV 137
+E ++ K + +E EL KR E+ Q V
Sbjct: 641 REKREKEAKVKADKEARELQKREELSAQQAAV 672


>sp|Q6CBW0|NST1_YARLI Stress response protein NST1 OS=Yarrowia
lipolytica GN=NST1 PE=3 SV=1
Length = 889

Score = 50.4 bits (119), Expect = 6e-06
Identities = 48/197 (24%), Positives = 90/197 (45%), Gaps = 4/197 (2%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+E D + RK E + + E + +A + EE + + +EA+R EAE+K
Sbjct: 389 KEARDQQRRERKKEKKRAQKAIKEEEKRKAAAEREEREKREAEEAERLRLEAERKQQEKE 448

Query: 400 EEMAAERFRFQ-KEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSE---RAR 233
E AA + + K+ A E + + + KEK+ + + RAR
Sbjct: 449 REKAARKAASEAKQKARQEEQARLAREKEEKRLARIREMEERMRLAKEKEEREKEELRAR 508

Query: 232 HQKELDDRKQRHQQEVMELTKRLEVERSQRDVLERKLQEVEHLVKQKGKSELGGQEQILL 53
Q+E D+R+++ +RLE ER + + LE + E E L K++ + L +++
Sbjct: 509 QQQEEDERREK---------ERLEEERIENERLEAERIENERLEKEREQQRLEEEKERQR 559

Query: 52 LTSQCKEQSHMREKAEK 2
+ + +E+ + E+ EK
Sbjct: 560 IKEE-REKQKLEEEREK 575


>sp|A7EMM3|NST1_SCLS1 Stress response protein nst1 OS=Sclerotinia
sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=nst1
PE=3 SV=1
Length = 1171

Score = 50.4 bits (119), Expect = 6e-06
Identities = 51/173 (29%), Positives = 80/173 (46%), Gaps = 4/173 (2%)
Frame = -3

Query: 508 ERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTLEE---MAAERFRFQKEH-AETAHX 341
ERQ + + + EEE A + +A+KK LE+ +A E+ R + E AE A
Sbjct: 538 ERQQKLLEELEEESRADSLRKAKKAKDAQKKKEKLLEKKRALAEEKARKEAEKAAEEASL 597

Query: 340 XXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERARHQKELDDRKQRHQQEVMELTKRLE 161
EN + QK K + ER R + E KQR QE E ++ E
Sbjct: 598 REIEEKKAEEQRLKREENRKKKEAQK-KADEEERVRKEAE----KQRRLQEQRE--RQAE 650

Query: 160 VERSQRDVLERKLQEVEHLVKQKGKSELGGQEQILLLTSQCKEQSHMREKAEK 2
ER QR+ ER+ +E E L +Q +++ +++ ++ + + H REK EK
Sbjct: 651 QERKQREAKEREKKEKEELRRQALEAKEAKEKE-----AKERREKHEREKREK 698



Score = 35.8 bits (81), Expect = 0.16
Identities = 33/154 (21%), Positives = 67/154 (43%), Gaps = 6/154 (3%)
Frame = -3

Query: 526 RLVAENERQSQAVFDAEE----EMEAKIQEAQRSVTEAEKKLATTLEEMAAERFRFQKEH 359
R +AE + + +A AEE E+E K E QR E +K ++ A E R +KE
Sbjct: 577 RALAEEKARKEAEKAAEEASLREIEEKKAEEQRLKREENRKKKEA-QKKADEEERVRKEA 635

Query: 358 AETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERARH--QKELDDRKQRHQQEV 185
+ + ++E + Q+ A+ +KE +R+++H++E
Sbjct: 636 EKQRRLQEQRERQAEQERKQREAKEREKKEKEELRRQALEAKEAKEKEAKERREKHEREK 695

Query: 184 MELTKRLEVERSQRDVLERKLQEVEHLVKQKGKS 83
E +++ ++ R++ +R+ + Q +S
Sbjct: 696 REKEAKVKADKEARELQKREEVAAQQAAVQAAQS 729



Score = 31.6 bits (70), Expect = 3.0
Identities = 32/143 (22%), Positives = 54/143 (37%), Gaps = 8/143 (5%)
Frame = -3

Query: 541 ETDLDRLVAENERQSQAVFDAEE------EMEAKIQEAQRSVTEAEKKLATTLEEMAAER 380
E L R ++++Q D EE E + ++QE + E E+K E E+
Sbjct: 607 EQRLKREENRKKKEAQKKADEEERVRKEAEKQRRLQEQRERQAEQERKQREAKEREKKEK 666

Query: 379 FRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERARHQKELDDR--K 206
+++ E KEK+ + R +H++E ++ K
Sbjct: 667 EELRRQALEAKE-------------------------AKEKEAKERREKHEREKREKEAK 701

Query: 205 QRHQQEVMELTKRLEVERSQRDV 137
+ +E EL KR EV Q V
Sbjct: 702 VKADKEARELQKREEVAAQQAAV 724


>sp|Q5RG44|K1211_DANRE Uncharacterized protein KIAA1211 homolog
OS=Danio rerio GN=si:dkeyp-117h8.2 PE=4 SV=3
Length = 1079

Score = 47.8 bits (112), Expect = 4e-05
Identities = 46/182 (25%), Positives = 82/182 (45%), Gaps = 11/182 (6%)
Frame = -3

Query: 514 ENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTLEE---MAAERFRFQKEHAETAH 344
E E++ + E+E E K+++ +R + E LEE E R QK E
Sbjct: 188 EEEKEHLEIKKREQEEERKMEKHRRMIEEQR------LEEEKRRRQEEERLQKVEEERKQ 241

Query: 343 XXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERARHQKELDDRK----QRHQQEVMEL 176
E + L ++E++ Q E R +KE ++RK +R QQE++
Sbjct: 242 REEEERKKREEEERRREEEERRLRHEEERKRQEEEERMKKEEEERKRAEEERRQQELLAE 301

Query: 175 TKRLEVERSQRDVLERKLQEVEHLVKQK----GKSELGGQEQILLLTSQCKEQSHMREKA 8
RLE ER +R+ ER+ +E E K++ + L +E + +C+++ R++
Sbjct: 302 RLRLEEER-KREQEERRRKEEEEAEKRRIQELQEKRLREEEHRIREEERCRQEEAERKRL 360

Query: 7 EK 2
E+
Sbjct: 361 EE 362



Score = 45.1 bits (105), Expect = 3e-04
Identities = 47/190 (24%), Positives = 75/190 (39%), Gaps = 10/190 (5%)
Frame = -3

Query: 541 ETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTLEEMAAERFRFQKE 362
E D + E E+ + VFD+ E I ++ EK E E +K
Sbjct: 141 EDDFSEIQEEFEKDEE-VFDSSREDYGIIHGSKEDYEPTEKSQRQRFHEEEKEHLEIKKR 199

Query: 361 HAETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERA------RHQKELDDRKQR 200
E Q L +K ++ + ER R Q+E ++RK+R
Sbjct: 200 EQEEERKMEKHRRMI---------EEQRLEEEKRRRQEEERLQKVEEERKQREEEERKKR 250

Query: 199 HQQEVMELTKRLEVERSQRDVLERKLQEVEHLVK----QKGKSELGGQEQILLLTSQCKE 32
++E +R E ER R ERK QE E +K ++ ++E ++Q LL E
Sbjct: 251 EEEE----RRREEEERRLRHEEERKRQEEEERMKKEEEERKRAEEERRQQELLAERLRLE 306

Query: 31 QSHMREKAEK 2
+ RE+ E+
Sbjct: 307 EERKREQEER 316



Score = 38.5 bits (88), Expect = 0.024
Identities = 42/171 (24%), Positives = 74/171 (43%), Gaps = 6/171 (3%)
Frame = -3

Query: 550 RKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTLEEMAAERFRF 371
R+ E + RL E ER+ Q EEE K +E +R E E++ +E+ AER R
Sbjct: 255 RRREEEERRLRHEEERKRQ-----EEEERMKKEEEERKRAEEERRQ----QELLAERLRL 305

Query: 370 QKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERARHQK------ELDDR 209
++E + L ++ + + ER R ++ E ++R
Sbjct: 306 EEERKREQEERRRKEEEEAEKRRIQELQEKRLREEEHRIREEERCRQEEAERKRLEEEER 365

Query: 208 KQRHQQEVMELTKRLEVERSQRDVLERKLQEVEHLVKQKGKSELGGQEQIL 56
K++ Q+E T E +R ++ R+++E + K S G++QIL
Sbjct: 366 KRQLQEEKAGSTDP-EWKRKAEELRWREMEERQRPFTFKVSS---GEKQIL 412


>sp|Q4PBP6|NST1_USTMA Stress response protein NST1 OS=Ustilago maydis
GN=NST1 PE=3 SV=1
Length = 1520

Score = 46.6 bits (109), Expect = 9e-05
Identities = 42/174 (24%), Positives = 80/174 (45%), Gaps = 6/174 (3%)
Frame = -3

Query: 508 ERQSQAVFDAEEEME-AKIQEAQRSVTEAEKKLATTLEEMAAERFRFQKEHAETAHXXXX 332
ERQ Q + + EEE + K +EA+R +KK + A E R +K+ E A
Sbjct: 837 ERQLQLLRELEEEDDNEKAREARRMKESQKKKDKKKAQREAKEAERLKKDQ-ERAAAEAE 895

Query: 331 XXXXXXXXXXXXXENTQTLHVQKEKQMQSERARHQKELDDRKQRHQQEVMELTKRLEVER 152
+ + + ++KE + +AR ++ ++R +++ E ++LEVER
Sbjct: 896 VRAQQQAQRDAELKKQEEIRLKKEAE---RKAREDEKAKKDEERRRRQAEERERQLEVER 952

Query: 151 SQRDV-----LERKLQEVEHLVKQKGKSELGGQEQILLLTSQCKEQSHMREKAE 5
+R+ LER+LQE +++ + + ++Q + + K + KAE
Sbjct: 953 KRREKEEKIRLERELQEKAKRDREEAQRKAKEEQQRVQRAKELKAKEEQERKAE 1006


tr_hit_id A9RKE8
Definition tr|A9RKE8|A9RKE8_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 202
Score (bit) 92.8
E-value 1.0e-17
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911791|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_C02.
(582 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RKE8|A9RKE8_PHYPA Predicted protein (Fragment) OS=Physcomit... 93 1e-17
tr|A9RQJ1|A9RQJ1_PHYPA Predicted protein (Fragment) OS=Physcomit... 87 5e-16
tr|A7PI02|A7PI02_VITVI Chromosome chr13 scaffold_17, whole genom... 82 2e-14
tr|A7PYA5|A7PYA5_VITVI Chromosome chr15 scaffold_37, whole genom... 82 3e-14
tr|A7QK89|A7QK89_VITVI Chromosome chr2 scaffold_112, whole genom... 80 1e-13
tr|A3B870|A3B870_ORYSJ Putative uncharacterized protein OS=Oryza... 72 3e-11
tr|A2Y909|A2Y909_ORYSI Putative uncharacterized protein OS=Oryza... 72 3e-11
tr|A9TPE1|A9TPE1_PHYPA Predicted protein (Fragment) OS=Physcomit... 69 2e-10
tr|A5BIN7|A5BIN7_VITVI Putative uncharacterized protein OS=Vitis... 68 4e-10
tr|B8AND9|B8AND9_ORYSI Putative uncharacterized protein OS=Oryza... 64 8e-09
tr|A3AE81|A3AE81_ORYSJ Putative uncharacterized protein OS=Oryza... 63 1e-08
tr|A7F6J3|A7F6J3_SCLS1 Predicted protein OS=Sclerotinia scleroti... 55 3e-06
tr|A2ENS5|A2ENS5_TRIVA Putative uncharacterized protein OS=Trich... 55 4e-06
tr|A0C7N6|A0C7N6_PARTE Chromosome undetermined scaffold_155, who... 54 5e-06
tr|Q4RIP0|Q4RIP0_TETNG Chromosome 7 SCAF15042, whole genome shot... 53 1e-05
tr|A2EUZ9|A2EUZ9_TRIVA Kelch motif family protein OS=Trichomonas... 53 1e-05
tr|Q86KE2|Q86KE2_DICDI Similar to Dictyostelium discoideum (Slim... 52 2e-05
tr|Q554L0|Q554L0_DICDI RING Zn finger-containing protein OS=Dict... 52 2e-05
tr|Q86AC9|Q86AC9_DICDI Similar to Kaposi's sarcoma-associated he... 52 2e-05
tr|A2FV34|A2FV34_TRIVA Trichohyalin, putative OS=Trichomonas vag... 52 2e-05
tr|A2DVB9|A2DVB9_TRIVA Putative uncharacterized protein OS=Trich... 52 2e-05
tr|O96063|O96063_DUGJA Myosin heavy chain (Fragment) OS=Dugesia ... 51 4e-05
tr|Q9QR71|Q9QR71_HHV8 ORF73 OS=Human herpesvirus 8 type P GN=ORF... 51 5e-05
tr|Q91LX9|Q91LX9_HHV8 ORF73 OS=Human herpesvirus 8 PE=4 SV=1 51 5e-05
tr|O40947|O40947_HHV8 ORF 73 OS=Human herpesvirus 8 PE=4 SV=1 51 5e-05
tr|A2FSV7|A2FSV7_TRIVA Putative uncharacterized protein OS=Trich... 51 5e-05
tr|A2FKU0|A2FKU0_TRIVA Viral A-type inclusion protein, putative ... 51 5e-05
tr|A2E3F2|A2E3F2_TRIVA Putative uncharacterized protein OS=Trich... 51 5e-05
tr|B5H2D1|B5H2D1_STRCL Putative uncharacterized protein OS=Strep... 50 7e-05
tr|Q8IIX7|Q8IIX7_PLAF7 Putative uncharacterized protein OS=Plasm... 50 7e-05

>tr|A9RKE8|A9RKE8_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_115724 PE=3 SV=1
Length = 860

Score = 92.8 bits (229), Expect = 1e-17
Identities = 62/202 (30%), Positives = 107/202 (52%), Gaps = 12/202 (5%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+EEFDYKSLCR++E +LDRLVAENERQ + + +EE++ ++E+++ V EAE +L T +
Sbjct: 355 KEEFDYKSLCRRMEAELDRLVAENERQIKIRLENDEELDRVVEESRQLVMEAETRLQTAM 414

Query: 400 EEMAAERFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERARHQKE 221
+ + + QKE E + +K++ + +HQ E
Sbjct: 415 D---VQNLKLQKEMTEKME-------------------------KHQKELMQQVEKHQLE 446

Query: 220 L------DDRKQRHQ-----QEVMELTKRLEVERSQRDVLERKLQEVEHLVKQKG-KSEL 77
L + R++ HQ +E+ EL+ LE ER +R+ LE++L+ + + ++G L
Sbjct: 447 LATALENEKREREHQSVGQSKEIAELSTLLENERQKREELEQELKSTKTQMSKRGVNGSL 506

Query: 76 GGQEQILLLTSQCKEQSHMREK 11
Q+ LLT + + +RE+
Sbjct: 507 TKQQGDELLTVRHRLDEELRER 528


>tr|A9RQJ1|A9RQJ1_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_118031 PE=3 SV=1
Length = 845

Score = 87.4 bits (215), Expect = 5e-16
Identities = 60/174 (34%), Positives = 89/174 (51%), Gaps = 19/174 (10%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+EEFDYKSLCR+LET+LDR+VAENER ++ D+E+E ++ +A++ V EAE KLA L
Sbjct: 354 KEEFDYKSLCRRLETELDRMVAENERLVKSREDSEDECARQLDDARQDVYEAESKLAHAL 413

Query: 400 EEMAAE-----RFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQS--- 245
EE+A + R +E E +L + EKQMQ
Sbjct: 414 EELAETVALYMQERAHRERLENELASQRELFSMAIQSGEHSSEVMSLRLSLEKQMQKNDQ 473

Query: 244 --------ERARHQKELDDRKQRHQQEVMELTKRLEVERSQRDVLE---RKLQE 116
+ + +K + Q+ E++ L +RLE E +R LE R+L+E
Sbjct: 474 LEQELRALKSSASRKSMKGNIQKQSDELLTLRQRLEDELKERGRLESENRQLRE 527


>tr|A7PI02|A7PI02_VITVI Chromosome chr13 scaffold_17, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00018145001
PE=3 SV=1
Length = 995

Score = 82.0 bits (201), Expect = 2e-14
Identities = 58/191 (30%), Positives = 98/191 (51%), Gaps = 7/191 (3%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+EEFDY+SLCRKLE +D+L E ERQ + + +E+E ++ E Q + EAEK L T
Sbjct: 387 KEEFDYESLCRKLEKQVDQLTEEIERQQKLRKNDTDELEKRLIECQNTFAEAEKNLVTRS 446

Query: 400 EEMAAERFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERARHQKE 221
E + E R + E + + + + ++ KQ Q E + Q+
Sbjct: 447 EFLEKENTRLELEMKDFLNELNHQKDLNVLMRDEVA--SLEMSLKHSKQYQLENSTCQQV 504

Query: 220 LDDRKQRHQQEVMELTKRLEVERS-------QRDVLERKLQEVEHLVKQKGKSELGGQEQ 62
L D Q +++++ EL K+L ER+ Q DV+++ L E + ++Q+ K+E ++
Sbjct: 505 LADTTQMYEKKIAELIKQLGDERARYETAGEQLDVIKKLLSESQQKIQQQ-KTENSTYQK 563

Query: 61 ILLLTSQCKEQ 29
L T+Q E+
Sbjct: 564 ALADTTQMYEK 574



Score = 44.3 bits (103), Expect = 0.005
Identities = 38/166 (22%), Positives = 77/166 (46%), Gaps = 6/166 (3%)
Frame = -3

Query: 580 REEFDYKSLCRKL--ETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEA----EK 419
R E + K +L + DL+ L+ + + ++ + + Q+ + + EK
Sbjct: 455 RLELEMKDFLNELNHQKDLNVLMRDEVASLEMSLKHSKQYQLENSTCQQVLADTTQMYEK 514

Query: 418 KLATTLEEMAAERFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSER 239
K+A ++++ ER R+ ETA QK +Q ++E
Sbjct: 515 KIAELIKQLGDERARY-----ETAGEQLDVIKKLLSESQ-----------QKIQQQKTEN 558

Query: 238 ARHQKELDDRKQRHQQEVMELTKRLEVERSQRDVLERKLQEVEHLV 101
+ +QK L D Q +++++ ELTK+LE E ++ + E++L E ++L+
Sbjct: 559 STYQKALADTTQMYEKKIAELTKQLEDEHARFEGAEKQLDEAKNLL 604


>tr|A7PYA5|A7PYA5_VITVI Chromosome chr15 scaffold_37, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00026364001
PE=3 SV=1
Length = 872

Score = 81.6 bits (200), Expect = 3e-14
Identities = 59/196 (30%), Positives = 98/196 (50%), Gaps = 3/196 (1%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+EEFDYKSL R+L+ LD+L+AENERQ +A EEE+E EAQ+ V+E E+ A L
Sbjct: 389 KEEFDYKSLSRRLDIQLDKLIAENERQQKAF---EEEVERITLEAQKRVSEVERNYADAL 445

Query: 400 EEMAAERFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERARHQKE 221
E+ ER + Q E+ E+ KQ++ + +QK+
Sbjct: 446 EK---ERLKCQMEYMESV-----------------------------KQLEEKLVTNQKK 473

Query: 220 L---DDRKQRHQQEVMELTKRLEVERSQRDVLERKLQEVEHLVKQKGKSELGGQEQILLL 50
+ +E+ E+ K L+ E R E ++ +++ + Q + E GG +IL L
Sbjct: 474 WCNGEGPGVSGAEELAEVKKLLQNEIHLRKAAEEEVDYLKNRLGQFTQPEAGGNSEILKL 533

Query: 49 TSQCKEQSHMREKAEK 2
++++H ++K E+
Sbjct: 534 RKSLEDEAHKKKKLEE 549


>tr|A7QK89|A7QK89_VITVI Chromosome chr2 scaffold_112, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00001024001
PE=3 SV=1
Length = 844

Score = 79.7 bits (195), Expect = 1e-13
Identities = 57/202 (28%), Positives = 99/202 (49%), Gaps = 9/202 (4%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+EEFDYKSL R+LE LD+L+ E+ERQ +A E+E+E E Q ++E E+ A L
Sbjct: 344 KEEFDYKSLSRRLEIQLDKLIVEHERQQKAF---EDEVERITVETQNHISETERNYADAL 400

Query: 400 EEMAAERFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERARHQKE 221
E+ ER ++Q+++ ++ + + V +++ SER +
Sbjct: 401 EK---ERLKYQEDYMQS------------------IKKLEEQWVMNQRKHGSERTTFGLK 439

Query: 220 LDDRKQ---------RHQQEVMELTKRLEVERSQRDVLERKLQEVEHLVKQKGKSELGGQ 68
D+ + +E+ EL K L+ E S R E ++ ++ V Q + E G
Sbjct: 440 DDNFDKTLNGVVPVASAAEEIAELKKLLQNEASLRTATEEEVNNLKSQVVQWKRIEAAGN 499

Query: 67 EQILLLTSQCKEQSHMREKAEK 2
+IL L ++++H +EK E+
Sbjct: 500 SEILKLRKMLEDEAHQKEKLEE 521


>tr|A3B870|A3B870_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_019242 PE=3 SV=1
Length = 824

Score = 71.6 bits (174), Expect = 3e-11
Identities = 51/169 (30%), Positives = 86/169 (50%), Gaps = 16/169 (9%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+EEFDYKSLCR+L+ +LD+L+AENERQ + FD +E+E EAQ VTEAE++ +L
Sbjct: 340 KEEFDYKSLCRRLDIELDKLIAENERQ-RKYFD--DEIERITAEAQLRVTEAEREYKISL 396

Query: 400 EEMAAERFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHV---QKEKQMQSERARH 230
E E+ ++ +E+ ++ + T+ + + +Q+E+
Sbjct: 397 EN---EKAKYHQEYLDSIKILEEKWKIHQQSPKKLIKETEPTSSEVGEVQNLLQNEKVLR 453

Query: 229 QKELDDRKQRHQQ-------------EVMELTKRLEVERSQRDVLERKL 122
Q D+ Q EV++L K L+ E SQ++ L+ ++
Sbjct: 454 QSAEDEANDLKNQVLHWKKMEAAATAEVVKLRKMLDTEASQKEKLDEEI 502


>tr|A2Y909|A2Y909_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_21543 PE=3 SV=1
Length = 891

Score = 71.6 bits (174), Expect = 3e-11
Identities = 51/169 (30%), Positives = 86/169 (50%), Gaps = 16/169 (9%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+EEFDYKSLCR+L+ +LD+L+AENERQ + FD +E+E EAQ VTEAE++ +L
Sbjct: 407 KEEFDYKSLCRRLDIELDKLIAENERQ-RKYFD--DEIERITAEAQLRVTEAEREYKISL 463

Query: 400 EEMAAERFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHV---QKEKQMQSERARH 230
E E+ ++ +E+ ++ + T+ + + +Q+E+
Sbjct: 464 EN---EKAKYHQEYLDSIKILEEKWKIHQQSPKKLIKETEPTSSEVGEVQNLLQNEKVLR 520

Query: 229 QKELDDRKQRHQQ-------------EVMELTKRLEVERSQRDVLERKL 122
Q D+ Q EV++L K L+ E SQ++ L+ ++
Sbjct: 521 QSAEDEANDLKNQVLHWKKMEAAATAEVVKLRKMLDTEASQKEKLDEEI 569


>tr|A9TPE1|A9TPE1_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_148565 PE=3 SV=1
Length = 833

Score = 68.9 bits (167), Expect = 2e-10
Identities = 58/191 (30%), Positives = 92/191 (48%), Gaps = 1/191 (0%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+EEFDYKSLCR++E +LDRLVAENERQ +A + +EE++ + E L L
Sbjct: 344 KEEFDYKSLCRRMEAELDRLVAENERQVKARMENDEELDRTSDNQSMEIAE----LRALL 399

Query: 400 EEMAAERFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQKEKQMQSERARHQKE 221
E+ +R + ++ +E + + +QSER QK
Sbjct: 400 EKERQKRKQSDEQSSEIS--------------------------ELRALLQSER---QKI 430

Query: 220 LDDRKQRHQQEVMELTKRLEVERSQRDVLERKLQEVE-HLVKQKGKSELGGQEQILLLTS 44
+ +Q EV EL LE ER +R+ LE++L+ + + K+ L Q+ LLT
Sbjct: 431 IQFEEQ--TIEVAELRTLLEGERQKREQLEQELRVAKTQMSKRSVNGSLTRQQGDELLTV 488

Query: 43 QCKEQSHMREK 11
+ + +RE+
Sbjct: 489 RHRLDEELRER 499


>tr|A5BIN7|A5BIN7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_029907 PE=3 SV=1
Length = 960

Score = 67.8 bits (164), Expect = 4e-10
Identities = 38/77 (49%), Positives = 52/77 (67%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+EEFDYKSL R+L+ LD+L+AENERQ +A EEE+E EAQ+ V+E E+ A L
Sbjct: 412 KEEFDYKSLSRRLDIQLDKLIAENERQQKAF---EEEVERITLEAQKRVSEVERNYADAL 468

Query: 400 EEMAAERFRFQKEHAET 350
E+ ER + Q E+ E+
Sbjct: 469 EK---ERLKCQMEYMES 482


>tr|B8AND9|B8AND9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10058 PE=4 SV=1
Length = 905

Score = 63.5 bits (153), Expect = 8e-09
Identities = 45/182 (24%), Positives = 90/182 (49%), Gaps = 11/182 (6%)
Frame = -3

Query: 580 REEFDYKSLCRKLETDLDRLVAENERQSQAVFDAEEEMEAKIQEAQRSVTEAEKKLATTL 401
+EE DY+SL +K+E ++D L +E ERQ + + ++E K++E++ S+ + + +
Sbjct: 367 KEEVDYESLYKKVEHEVDHLTSEMERQQKLKNSEKMQLEKKLKESEASLNDLKVTSNMQI 426

Query: 400 EEMAAERFRFQKEHAETAHXXXXXXXXXXXXXXXXXENTQTLHVQ----KEKQMQSERAR 233
E MA E+ + + + + Q +H++ + KQ Q E
Sbjct: 427 ENMAMEKCQLE------STIKRLMLDLEKEKGKNNILSEQIIHLETSLDENKQKQLENIS 480

Query: 232 HQKELDDRKQRHQQEVMELTKRLEVERSQR-------DVLERKLQEVEHLVKQKGKSELG 74
+ L D + H++++ EL K+LE ERS+ +VL+++L + ++ ++ EL
Sbjct: 481 NTNILADTTKSHEKKIRELLKQLEDERSRSASMNDHLNVLQQQLSDAQNYFQENIACELE 540

Query: 73 GQ 68
Q
Sbjct: 541 KQ 542