BP911795
Clone id YMU001_000009_C06
Library
Length 427
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000009_C06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CACACACAGCTCGGAAGCTAGAATGCTCCGAGCAGACACCAAATGTTTCTAACCCATGTT
AGGTTAACTCATTTGCCAAGACAATGATATCCAAGTGCCCTTTGCAATCTCCCCTTGAAT
ACCATAGAGGTGATGTTTTTTAGATTACTTCACTGTGCATCCACACGTTTGGCTCCAACA
ATGAGAATAGTTCGACTCCACACAAAAGTTTCTTCCTCACTTGTCATCTTCATTTTAAAG
TACCACATGATGCATAACCATATGTACAAATTACTGTAAGATAATAAGGCCTATGCATAC
ACAACGGACAGAATTGATTGATAAGAGTATTATTTTCAAAGGATTTGAACAACACCCTAG
CAAACCTATAAAGGTTTCTATGAGACTAGAAAGTAGGTAACCCACCAAAGCTGTCGAACA
CTAGTGG
■■Homology search results ■■ -
sp_hit_id A2T377
Definition sp|A2T377|NU2C_ANGEV NAD(P)H-quinone oxidoreductase chain 2, chloroplastic OS=Angiopteris evecta
Align length 43
Score (bit) 28.9
E-value 9.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911795|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_C06.
(427 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A2T377|NU2C_ANGEV NAD(P)H-quinone oxidoreductase chain 2, chl... 29 9.1

>sp|A2T377|NU2C_ANGEV NAD(P)H-quinone oxidoreductase chain 2,
chloroplastic OS=Angiopteris evecta GN=ndhB1 PE=3 SV=1
Length = 494

Score = 28.9 bits (63), Expect = 9.1
Identities = 16/43 (37%), Positives = 23/43 (53%)
Frame = -2

Query: 414 TALVGYLLSSLIETFIGLLGCCSNPLKIILLSINSVRCVCIGL 286
TAL +LL L T G+ CC+N L I +++ C+GL
Sbjct: 106 TALTEFLLFILTATLGGMFLCCANDLVTIFVALE-----CLGL 143


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911795|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_C06.
(427 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******