BP911814
Clone id YMU001_000009_E03
Library
Length 539
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000009_E03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GATGATAGCCTGTATGGCCTACAAAGCTTTGAACACCTTTGGGATTAAGTGGAGGGGGCA
ATGTTAAAATGGCCACTATTTTCTCAGGGTCAGGTGCTAAACCTTCAGCAGACACGACAT
GACCTAAAAGCGTAGCTTGAGTCACCAAAAAAGTCGCACTTGTTTGATTGAGCTTAAGGC
GCGCCTCGCGACCCTTTGAGAAGATTGCTAAGAGTTGAGCTAAGTGCTCCTCCAAGTTTT
CCACGGGGGTGGAACATTGGGCGCCAGAGAAGGTGGAAAAATCATCCATGAAGATTCTAA
GATTATCGTTGAGCAGGGGACGAAATATGATGTAGACAATACGATTGAATGAAGGAGGAG
GGTTTTTTACTTGTAGATAAACATTCCCCATGGAGTGACAAAAGCTGTCTTTCCTTGGTC
GTCAAGATGTATGCCTAACTGATTGTAGCCGCTGAACCCGTCCATGAAACTGTACAGTAC
ATGCCCAGCGACATCTTCAAGAACTCTCTTAGTGAAAGGGGTCGGAAATCCATCCAGAA
■■Homology search results ■■ -
sp_hit_id P04323
Definition sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster
Align length 123
Score (bit) 95.5
E-value 7.0e-21
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911814|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_E03.
(539 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from tra... 96 7e-21
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from tra... 89 3e-19
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from tra... 73 6e-15
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from tra... 57 3e-10
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from tra... 51 9e-09
sp|Q05654|RTF21_SCHPO Retrotransposable element Tf2 155 kDa prot... 47 5e-05
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Sa... 47 6e-05
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Sa... 47 6e-05
sp|Q9UR07|RTF23_SCHPO Retrotransposable element Tf2 155 kDa prot... 45 2e-04
sp|Q9C0R2|RTF22_SCHPO Retrotransposable element Tf2 155 kDa prot... 45 2e-04
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg0... 45 3e-04
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorha... 40 0.009
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (... 39 0.012
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogen... 38 0.036
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic m... 35 0.30
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing... 34 0.40
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing... 34 0.40
sp|Q08289|CACB2_HUMAN Voltage-dependent L-type calcium channel s... 31 4.4
sp|Q5XPI4|RN123_HUMAN E3 ubiquitin-protein ligase RNF123 OS=Homo... 30 5.7
sp|P47533|P69_MYCGE ABC transport system permease protein p69 OS... 30 5.7
sp|Q14493|SLBP_HUMAN Histone RNA hairpin-binding protein OS=Homo... 30 7.5
sp|P57678|GEMI4_HUMAN Component of gems 4 OS=Homo sapiens GN=GEM... 30 7.5
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus... 30 9.8
sp|Q7W488|AZOR_BORPA FMN-dependent NADH-azoreductase OS=Bordetel... 30 9.8
sp|Q7WFP6|AZOR_BORBR FMN-dependent NADH-azoreductase OS=Bordetel... 30 9.8

>sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from
transposon 17.6 OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1058

Score = 95.5 bits (236), Expect(2) = 7e-21
Identities = 50/123 (40%), Positives = 72/123 (58%)
Frame = -2

Query: 370 VKNPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKG 191
+KN P +F R + I RPLLN + +++DD FS +L+EHL L +F K
Sbjct: 338 LKNAPATFQRCMNDILRPLLNKHCLVYLDDIIVFS--------TSLDEHLQSLGLVFEKL 389

Query: 190 REARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHT 11
+A LKL FL + T LGHV++ +G+ P+PEKI AI P P PK +++F+G T
Sbjct: 390 AKANLKLQLDKCEFLKQETTFLGHVLTPDGIKPNPEKIEAIQKYPIPTKPKEIKAFLGLT 449

Query: 10 GYH 2
GY+
Sbjct: 450 GYY 452



Score = 25.0 bits (53), Expect(2) = 7e-21
Identities = 14/54 (25%), Positives = 25/54 (46%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMFIY 373
D P P +L + ++ +D G++Q+ + + KTAF T G + Y
Sbjct: 278 DRHPIPNMDEILGKLGRCNYFTTIDLAKGFHQIEMDPESVSKTAFSTKHGHYEY 331


>sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from
transposon 297 OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1059

Score = 89.0 bits (219), Expect(2) = 3e-19
Identities = 45/123 (36%), Positives = 72/123 (58%)
Frame = -2

Query: 370 VKNPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKG 191
++N P +F R + I RPLLN + +++DD FS +L EHL + +F+K
Sbjct: 337 LRNAPATFQRCMNNILRPLLNKHCLVYLDDIIIFS--------TSLTEHLNSIQLVFTKL 388

Query: 190 REARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHT 11
+A LKL FL +A LGH+V+ +G+ P+P K+ AI++ P P K +++F+G T
Sbjct: 389 ADANLKLQLDKCEFLKKEANFLGHIVTPDGIKPNPIKVKAIVSYPIPTKDKEIRAFLGLT 448

Query: 10 GYH 2
GY+
Sbjct: 449 GYY 451



Score = 26.2 bits (56), Expect(2) = 3e-19
Identities = 14/54 (25%), Positives = 26/54 (48%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMFIY 373
D +P P +L + ++ +D G++Q+ + + KTAF T G + Y
Sbjct: 277 DRYPIPNMDEILGKLGKCQYFTTIDLAKGFHQIEMDEESISKTAFSTKSGHYEY 330


>sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from
transposon opus OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1003

Score = 73.2 bits (178), Expect(2) = 6e-15
Identities = 39/123 (31%), Positives = 67/123 (54%)
Frame = -2

Query: 370 VKNPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKG 191
+KN P F R++ I R + +++DD FS E+ + H L + +
Sbjct: 254 LKNAPAIFQRMIDDILREHIGKVCYVYIDDIIVFS--------EDYDTHWKNLRLVLASL 305

Query: 190 REARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHT 11
+A L++N + FL TQ LG++V+A+G+ DP+K+ AI +PPP + K ++ F+G T
Sbjct: 306 SKANLQVNLEKSHFLDTQVEFLGYIVTADGIKADPKKVRAISEMPPPTSVKELKRFLGMT 365

Query: 10 GYH 2
Y+
Sbjct: 366 SYY 368



Score = 27.3 bits (59), Expect(2) = 6e-15
Identities = 15/52 (28%), Positives = 25/52 (48%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMF 379
D +P P L + ++ +D SG++Q+ + D KTAF T G +
Sbjct: 194 DTYPIPDINATLASLGNAKYFTTLDLTSGFHQIHMKESDIPKTAFSTLNGKY 245


>sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from
transposon 412 OS=Drosophila melanogaster GN=POL PE=4
SV=1
Length = 1237

Score = 57.0 bits (136), Expect(2) = 3e-10
Identities = 38/124 (30%), Positives = 57/124 (45%), Gaps = 1/124 (0%)
Frame = -2

Query: 370 VKNPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEH-LAQLLAIFSK 194
+K P SF R++ I F + ++MDD CS E+H L L +F K
Sbjct: 446 LKIAPNSFQRMMTIAFSGIEPSQAFLYMDDLIVIG---CS------EKHMLKNLTEVFGK 496

Query: 193 GREARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGH 14
RE LKL+ +F + + T LGH + +G+ PD +K I P P + + FV
Sbjct: 497 CREYNLKLHPEKCSFFMHEVTFLGHKCTDKGILPDDKKYDVIQNYPVPHDADSARRFVAF 556

Query: 13 TGYH 2
Y+
Sbjct: 557 CNYY 560



Score = 27.3 bits (59), Expect(2) = 3e-10
Identities = 14/52 (26%), Positives = 26/52 (50%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMF 379
D FP P +L+ + +S +D SG++Q+ + + T+F T G +
Sbjct: 386 DKFPLPRIDDILDQLGRAKYFSCLDLMSGFHQIELDEGSRDITSFSTSNGSY 437


>sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from
transposon gypsy OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1035

Score = 50.8 bits (120), Expect(2) = 9e-09
Identities = 32/123 (26%), Positives = 55/123 (44%)
Frame = -2

Query: 370 VKNPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKG 191
++N F R + + R + +++DD FS EN +H+ + +
Sbjct: 313 LRNASSIFQRALDDVLREQIGKICYVYVDDVIIFS--------ENESDHVRHIDTVLKCL 364

Query: 190 REARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHT 11
+A ++++Q F LG +VS +G DPEK+ AI P P V+SF+G
Sbjct: 365 IDANMRVSQEKTRFFKESVEYLGFIVSKDGTKSDPEKVKAIQEYPEPDCVYKVRSFLGLA 424

Query: 10 GYH 2
Y+
Sbjct: 425 SYY 427



Score = 28.5 bits (62), Expect(2) = 9e-09
Identities = 14/52 (26%), Positives = 27/52 (51%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMF 379
D +P P +L ++ ++ +D SGY+Q+ + D+ KT+F G +
Sbjct: 253 DRYPMPSIPMILANLGKAKFFTTLDLKSGYHQIYLAEHDREKTSFSVNGGKY 304


>sp|Q05654|RTF21_SCHPO Retrotransposable element Tf2 155 kDa protein
type 1 OS=Schizosaccharomyces pombe GN=Tf2-1 PE=2 SV=1
Length = 1333

Score = 47.4 bits (111), Expect = 5e-05
Identities = 29/122 (23%), Positives = 50/122 (40%)
Frame = -2

Query: 370 VKNPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKG 191
+ P F + I ++ +MDD S ++ EH+ + + K
Sbjct: 538 ISTAPAHFQYFINTILGEAKESHVVCYMDDILIHSKSE--------SEHVKHVKDVLQKL 589

Query: 190 REARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHT 11
+ A L +NQ F +Q +G+ +S +G P E I +L P N K ++ F+G
Sbjct: 590 KNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFLGSV 649

Query: 10 GY 5
Y
Sbjct: 650 NY 651


>sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY3B-I PE=3 SV=2
Length = 1498

Score = 47.0 bits (110), Expect = 6e-05
Identities = 33/121 (27%), Positives = 51/121 (42%)
Frame = -2

Query: 364 NPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKGRE 185
N P +F R + FR L N +++DD FS E+ EEH L + + +
Sbjct: 750 NAPSTFARYMADTFRDLRFVN--VYLDDILIFS--------ESPEEHWKHLDTVLERLKN 799

Query: 184 ARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHTGY 5
L + + F + LG+ + + +AP K AI P P K Q F+G Y
Sbjct: 800 ENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINY 859

Query: 4 H 2
+
Sbjct: 860 Y 860



Score = 42.0 bits (97), Expect = 0.002
Identities = 24/71 (33%), Positives = 39/71 (54%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMFIYK*KTLL 355
D FP P +L + +++ +D SGY+Q+ + D+ KTAFVTP G + Y T++
Sbjct: 688 DPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEY---TVM 744

Query: 354 LHSIVLSTSYF 322
+V + S F
Sbjct: 745 PFGLVNAPSTF 755


>sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY3B-G PE=1 SV=3
Length = 1547

Score = 47.0 bits (110), Expect = 6e-05
Identities = 33/121 (27%), Positives = 51/121 (42%)
Frame = -2

Query: 364 NPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKGRE 185
N P +F R + FR L N +++DD FS E+ EEH L + + +
Sbjct: 724 NAPSTFARYMADTFRDLRFVN--VYLDDILIFS--------ESPEEHWKHLDTVLERLKN 773

Query: 184 ARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHTGY 5
L + + F + LG+ + + +AP K AI P P K Q F+G Y
Sbjct: 774 ENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINY 833

Query: 4 H 2
+
Sbjct: 834 Y 834



Score = 42.0 bits (97), Expect = 0.002
Identities = 24/71 (33%), Positives = 39/71 (54%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMFIYK*KTLL 355
D FP P +L + +++ +D SGY+Q+ + D+ KTAFVTP G + Y T++
Sbjct: 662 DPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEY---TVM 718

Query: 354 LHSIVLSTSYF 322
+V + S F
Sbjct: 719 PFGLVNAPSTF 729


>sp|Q9UR07|RTF23_SCHPO Retrotransposable element Tf2 155 kDa protein
type 3 OS=Schizosaccharomyces pombe GN=Tf2-11 PE=4 SV=1
Length = 1333

Score = 45.4 bits (106), Expect = 2e-04
Identities = 28/118 (23%), Positives = 50/118 (42%)
Frame = -2

Query: 358 PPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKGREAR 179
P F + I + ++ +MD+ S ++ EH+ + + K + A
Sbjct: 542 PAHFQYFINTILGEVKESHVVCYMDNILIHSKSE--------SEHVKHVKDVLQKLKNAN 593

Query: 178 LKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHTGY 5
L +NQ F +Q +G+ +S +G P E I +L P N K ++ F+G Y
Sbjct: 594 LIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFLGSVNY 651


>sp|Q9C0R2|RTF22_SCHPO Retrotransposable element Tf2 155 kDa protein
type 2 OS=Schizosaccharomyces pombe GN=Tf2-7 PE=2 SV=1
Length = 1333

Score = 45.4 bits (106), Expect = 2e-04
Identities = 28/118 (23%), Positives = 50/118 (42%)
Frame = -2

Query: 358 PPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKGREAR 179
P F + I + ++ +MD+ S ++ EH+ + + K + A
Sbjct: 542 PAHFQYFINTILGEVKESHVVCYMDNILIHSKSE--------SEHVKHVKDVLQKLKNAN 593

Query: 178 LKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHTGY 5
L +NQ F +Q +G+ +S +G P E I +L P N K ++ F+G Y
Sbjct: 594 LIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFLGSVNY 651


tr_hit_id Q946T4
Definition tr|Q946T4|Q946T4_PEA Reverse transcriptase (Fragment) OS=Pisum sativum
Align length 121
Score (bit) 87.8
E-value 2.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911814|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_E03.
(539 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q946T4|Q946T4_PEA Reverse transcriptase (Fragment) OS=Pisum s... 88 2e-30
tr|Q0ZCD0|Q0ZCD0_POPTR Integrase OS=Populus trichocarpa PE=2 SV=1 84 3e-30
tr|A5B5E9|A5B5E9_VITVI Putative uncharacterized protein OS=Vitis... 85 8e-29
tr|Q946T2|Q946T2_PEA Reverse transcriptase (Fragment) OS=Pisum s... 88 1e-28
tr|A5B7Z3|A5B7Z3_VITVI Putative uncharacterized protein OS=Vitis... 82 1e-28
tr|Q946T1|Q946T1_SORBI Reverse transcriptase (Fragment) OS=Sorgh... 84 1e-28
tr|A5BW26|A5BW26_VITVI Putative uncharacterized protein OS=Vitis... 82 2e-28
tr|Q2AA50|Q2AA50_ASPOF Retrotransposon gag protein OS=Asparagus ... 82 2e-28
tr|A5AGT6|A5AGT6_VITVI Putative uncharacterized protein OS=Vitis... 82 2e-28
tr|Q2AA42|Q2AA42_ASPOF F7F22.17, putative OS=Asparagus officinal... 82 2e-28
tr|Q946T3|Q946T3_PEA Reverse transcriptase (Fragment) OS=Pisum s... 88 2e-28
tr|A5BM14|A5BM14_VITVI Putative uncharacterized protein OS=Vitis... 82 2e-28
tr|A5AJX5|A5AJX5_VITVI Putative uncharacterized protein OS=Vitis... 81 2e-28
tr|A5C6P7|A5C6P7_VITVI Putative uncharacterized protein OS=Vitis... 81 2e-28
tr|A5ALX3|A5ALX3_VITVI Putative uncharacterized protein OS=Vitis... 81 2e-28
tr|A5AQ03|A5AQ03_VITVI Putative uncharacterized protein OS=Vitis... 79 5e-28
tr|A5C050|A5C050_VITVI Putative uncharacterized protein OS=Vitis... 80 7e-28
tr|A5BUX2|A5BUX2_VITVI Putative uncharacterized protein OS=Vitis... 80 7e-28
tr|Q7X639|Q7X639_ORYSJ OSJNBb0067G11.5 protein OS=Oryza sativa s... 83 7e-28
tr|A5AZ28|A5AZ28_VITVI Putative uncharacterized protein OS=Vitis... 80 7e-28
tr|A5APE5|A5APE5_VITVI Putative uncharacterized protein OS=Vitis... 79 9e-28
tr|A5ANH7|A5ANH7_VITVI Putative uncharacterized protein OS=Vitis... 79 9e-28
tr|A5AEM1|A5AEM1_VITVI Putative uncharacterized protein OS=Vitis... 79 1e-27
tr|A5BAE8|A5BAE8_VITVI Putative uncharacterized protein OS=Vitis... 79 1e-27
tr|A5BI69|A5BI69_VITVI Putative uncharacterized protein OS=Vitis... 80 1e-27
tr|A5ANW2|A5ANW2_VITVI Putative uncharacterized protein OS=Vitis... 82 1e-27
tr|A5BXM1|A5BXM1_VITVI Putative uncharacterized protein OS=Vitis... 79 1e-27
tr|A5ATG4|A5ATG4_VITVI Putative uncharacterized protein OS=Vitis... 79 1e-27
tr|O22103|O22103_VICFA Reverse transcriptase-like protein (Fragm... 82 1e-27
tr|A5AIE4|A5AIE4_VITVI Putative uncharacterized protein OS=Vitis... 79 1e-27

>tr|Q946T4|Q946T4_PEA Reverse transcriptase (Fragment) OS=Pisum
sativum PE=4 SV=1
Length = 254

Score = 87.8 bits (216), Expect(2) = 2e-30
Identities = 43/121 (35%), Positives = 67/121 (55%)
Frame = -2

Query: 364 NPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKGRE 185
N P +F R + IF +L +++FMDDFS F + + LA L + + +E
Sbjct: 132 NAPATFQRCMTSIFSDMLEKYMKVFMDDFSVFGSS--------FDNCLANLSLVLQRCQE 183

Query: 184 ARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHTGY 5
L LN F+V + +LGH +S +G+ D K+ I LPPP+N KG++SF+GH G+
Sbjct: 184 TNLVLNWEKCHFMVQEGIVLGHKISHKGIEVDKAKVEVIANLPPPVNEKGIRSFLGHAGF 243

Query: 4 H 2
+
Sbjct: 244 Y 244



Score = 68.6 bits (166), Expect(2) = 2e-30
Identities = 29/55 (52%), Positives = 40/55 (72%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMFIYK 370
D FP PF ++LE +AGH Y F+DG+SGYNQ+ + +DQ KTAF P+G+F Y+
Sbjct: 70 DHFPLPFIDQMLERLAGHEYYCFLDGYSGYNQIVVAPEDQEKTAFTCPYGIFAYR 124


>tr|Q0ZCD0|Q0ZCD0_POPTR Integrase OS=Populus trichocarpa PE=2 SV=1
Length = 1139

Score = 83.6 bits (205), Expect(2) = 3e-30
Identities = 45/121 (37%), Positives = 66/121 (54%)
Frame = -2

Query: 364 NPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKGRE 185
N P +F R + IF ++ L IFMDDFS F ++ ++ L L + S+ E
Sbjct: 473 NAPATFQRCMLSIFSDMVERFLEIFMDDFSVFG--------DSFDDCLTNLEKVLSRCEE 524

Query: 184 ARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHTGY 5
L LN F+VT +LGH+VS++G+ D KI I LP P + K V+SF+GH G+
Sbjct: 525 KNLVLNWEKCHFMVTNGIVLGHIVSSKGIEVDKSKIELIANLPTPKSVKDVRSFLGHAGF 584

Query: 4 H 2
+
Sbjct: 585 Y 585



Score = 71.6 bits (174), Expect(2) = 3e-30
Identities = 31/55 (56%), Positives = 39/55 (70%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMFIYK 370
D FP PF ++LE VAGH Y F+DG+SGYNQ+ I L+DQ KT F P+G F Y+
Sbjct: 411 DHFPLPFMDQILERVAGHEFYCFLDGYSGYNQIEIALEDQEKTTFTCPFGTFAYR 465


>tr|A5B5E9|A5B5E9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_025860 PE=4 SV=1
Length = 1333

Score = 84.7 bits (208), Expect(2) = 8e-29
Identities = 42/121 (34%), Positives = 66/121 (54%)
Frame = -2

Query: 364 NPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKGRE 185
N P +F R + IIF ++ + +FMDD + + G+ +E L L A+F + E
Sbjct: 743 NAPATFQRCMLIIFSDMVERIMEVFMDDITIYGGSY--------KECLLHLEAVFQRCIE 794

Query: 184 ARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHTGY 5
L LN F+V Q +LGH++S G+ D + I+ LPPP N KG++ F+GH G+
Sbjct: 795 KDLVLNWEKCHFMVQQGIVLGHIISKNGIGVDKANVELIVKLPPPTNXKGIRQFLGHAGF 854

Query: 4 H 2
+
Sbjct: 855 Y 855



Score = 65.9 bits (159), Expect(2) = 8e-29
Identities = 29/55 (52%), Positives = 38/55 (69%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMFIYK 370
D FP PF +VLE V+GH Y F+DG+SGY Q+ I L++Q KT F P+G F Y+
Sbjct: 681 DHFPLPFMDQVLERVSGHPFYCFLDGYSGYFQIEIDLENQEKTTFTCPFGTFAYR 735


>tr|Q946T2|Q946T2_PEA Reverse transcriptase (Fragment) OS=Pisum
sativum PE=4 SV=1
Length = 254

Score = 88.2 bits (217), Expect(2) = 1e-28
Identities = 47/121 (38%), Positives = 65/121 (53%)
Frame = -2

Query: 364 NPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKGRE 185
N P +F R V IF L+ + +FMDDFS F G+ LA L + + +
Sbjct: 132 NAPATFQRCVQAIFVDLIEKTMEVFMDDFSVFGGS--------FSLCLANLKTVLERCVK 183

Query: 184 ARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHTGY 5
L LN F+VT+ +LGH VS GL D K+ I LPPP+N KG++SF+GH G+
Sbjct: 184 TNLVLNWEKCHFMVTEGIVLGHKVSRRGLEVDRAKVEVIEKLPPPVNVKGIRSFLGHAGF 243

Query: 4 H 2
+
Sbjct: 244 Y 244



Score = 62.0 bits (149), Expect(2) = 1e-28
Identities = 26/55 (47%), Positives = 37/55 (67%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMFIYK 370
D FP PF ++LE ++G Y F+DG+SGYNQ+ + D KTAF P+G+F Y+
Sbjct: 70 DHFPLPFMDQMLERLSGQQYYCFLDGYSGYNQIAVDPADHEKTAFTCPFGVFAYR 124


>tr|A5B7Z3|A5B7Z3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_015534 PE=4 SV=1
Length = 289

Score = 82.0 bits (201), Expect(2) = 1e-28
Identities = 41/121 (33%), Positives = 64/121 (52%)
Frame = -2

Query: 364 NPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKGRE 185
N P +F R + IF ++ + +FMDD + + + EE L L A+ + E
Sbjct: 136 NAPATFQRCMLSIFSDMVERIMEVFMDDITVYGSSY--------EERLLHLEAVLQRCIE 187

Query: 184 ARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHTGY 5
L LN F+V Q +LGH++S G+ D K+ I+ LPPP N KG++ F+GH G+
Sbjct: 188 KDLVLNWEKCHFMVQQGIVLGHIISKNGIEVDKAKVELIVKLPPPTNVKGIRQFLGHVGF 247

Query: 4 H 2
+
Sbjct: 248 Y 248



Score = 67.8 bits (164), Expect(2) = 1e-28
Identities = 30/55 (54%), Positives = 38/55 (69%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMFIYK 370
D FP PF +VLE V+GH Y F+DG+SGY Q+ I L+DQ KT F P+G F Y+
Sbjct: 74 DHFPLPFMDQVLERVSGHPFYCFLDGYSGYFQIEIDLEDQEKTTFTCPFGTFAYR 128


>tr|Q946T1|Q946T1_SORBI Reverse transcriptase (Fragment) OS=Sorghum
bicolor PE=4 SV=1
Length = 254

Score = 83.6 bits (205), Expect(2) = 1e-28
Identities = 44/121 (36%), Positives = 68/121 (56%)
Frame = -2

Query: 364 NPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKGRE 185
N P SF R + IF ++ + + +FMDDFS + G + +ENL++ + E
Sbjct: 132 NAPASFQRCMMSIFSDMIEEIMEVFMDDFSVY-GKAFDSCLENLDK-------VLQSCEE 183

Query: 184 ARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHTGY 5
L LN F+V + +LGH+VS G+ D +I I LPPP+N KG++SF+GH G+
Sbjct: 184 KHLILNWEKCHFMVREGIVLGHLVSERGIEVDKAEIEVIEQLPPPVNIKGIRSFLGHAGF 243

Query: 4 H 2
+
Sbjct: 244 Y 244



Score = 66.2 bits (160), Expect(2) = 1e-28
Identities = 27/55 (49%), Positives = 37/55 (67%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMFIYK 370
D FP PF +LE +A H + F+DG+SGY+Q+ IH DDQ KT F P+G + Y+
Sbjct: 70 DHFPLPFIDEMLERLANHSFFCFLDGYSGYHQIPIHPDDQSKTTFTCPYGTYAYR 124


>tr|A5BW26|A5BW26_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_038462 PE=4 SV=1
Length = 1986

Score = 81.6 bits (200), Expect(2) = 2e-28
Identities = 41/121 (33%), Positives = 65/121 (53%)
Frame = -2

Query: 364 NPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKGRE 185
N P +F R + IF ++ + +FMDD + + G+ +E L L A+ + E
Sbjct: 1395 NAPATFQRCMLSIFSDMVERIMEVFMDDITVYGGSY--------KECLLHLEAVLQRCIE 1446

Query: 184 ARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHTGY 5
L LN F+V Q +LGH++S G+ D K+ I+ LPPP N KG++ F+GH G+
Sbjct: 1447 KDLVLNWDKCYFMVQQGIVLGHIISKNGIEVDKAKVELIVKLPPPTNVKGIRQFLGHAGF 1506

Query: 4 H 2
+
Sbjct: 1507 Y 1507



Score = 67.8 bits (164), Expect(2) = 2e-28
Identities = 30/55 (54%), Positives = 38/55 (69%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMFIYK 370
D FP PF +VLE V+GH Y F+DG+SGY Q+ I L+DQ KT F P+G F Y+
Sbjct: 1333 DHFPLPFMDQVLERVSGHPFYCFLDGYSGYFQIEIDLEDQEKTTFTCPFGTFAYR 1387


>tr|Q2AA50|Q2AA50_ASPOF Retrotransposon gag protein OS=Asparagus
officinalis GN=19.t00014 PE=4 SV=1
Length = 1788

Score = 82.0 bits (201), Expect(2) = 2e-28
Identities = 46/121 (38%), Positives = 62/121 (51%)
Frame = -2

Query: 364 NPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKGRE 185
N P +F R + IF ++ L IFMDDFS F + + L L + + RE
Sbjct: 980 NAPATFQRCMISIFSDMVERFLEIFMDDFSIFG--------DTFSQCLHHLKLVLERCRE 1031

Query: 184 ARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHTGY 5
L LN F+V Q +LGHVVS G+ D K+ I LPPP K V+SF+GH G+
Sbjct: 1032 KNLTLNWEKCHFMVKQGIVLGHVVSNRGIEVDKAKVDIISNLPPPKTVKDVRSFLGHAGF 1091

Query: 4 H 2
+
Sbjct: 1092 Y 1092



Score = 67.4 bits (163), Expect(2) = 2e-28
Identities = 29/55 (52%), Positives = 38/55 (69%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMFIYK 370
D FP PF ++LE +AGH Y F+DG+SGYNQ+ I +DQ KT F P+G F Y+
Sbjct: 918 DHFPLPFIDQMLERLAGHEFYCFLDGYSGYNQIPIAPEDQEKTTFTCPYGTFAYR 972


>tr|A5AGT6|A5AGT6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_041615 PE=4 SV=1
Length = 1545

Score = 82.0 bits (201), Expect(2) = 2e-28
Identities = 41/121 (33%), Positives = 65/121 (53%)
Frame = -2

Query: 364 NPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKGRE 185
N P +F R + IF ++ + +FMDD + + G+ +E L L A+ + E
Sbjct: 923 NAPATFQRCMLSIFSDMVERIMEVFMDDITVYGGSY--------KECLLHLEAVLQRHIE 974

Query: 184 ARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHTGY 5
L LN F+V Q +LGH++S G+ D K+ I+ LPPP N KG++ F+GH G+
Sbjct: 975 KDLVLNWEKCHFMVQQGXVLGHIISKNGIEVDKAKVELIVKLPPPTNVKGIRQFLGHAGF 1034

Query: 4 H 2
+
Sbjct: 1035 Y 1035



Score = 67.4 bits (163), Expect(2) = 2e-28
Identities = 30/55 (54%), Positives = 38/55 (69%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMFIYK 370
D FP PF +VLE V+GH Y F+DG+SGY Q+ I L+DQ KT F P+G F Y+
Sbjct: 861 DHFPLPFMDQVLERVSGHPFYYFLDGYSGYFQIEIDLEDQEKTTFTCPFGTFAYR 915


>tr|Q2AA42|Q2AA42_ASPOF F7F22.17, putative OS=Asparagus officinalis
GN=19.t00017 PE=4 SV=1
Length = 680

Score = 82.0 bits (201), Expect(2) = 2e-28
Identities = 46/121 (38%), Positives = 62/121 (51%)
Frame = -2

Query: 364 NPPPSFNRIVYIIFRPLLNDNLRIFMDDFSTFSGAQCSTPVENLEEHLAQLLAIFSKGRE 185
N P +F R + IF ++ L IFMDDFS F + + L L + + RE
Sbjct: 285 NAPATFQRYMISIFSDMVERFLEIFMDDFSIFG--------DTFSQCLHHLKLVLERCRE 336

Query: 184 ARLKLNQTSATFLVTQATLLGHVVSAEGLAPDPEKIVAILTLPPPLNPKGVQSFVGHTGY 5
L LN F+V Q +LGHVVS G+ D K+ I LPPP K V+SF+GH G+
Sbjct: 337 KNLTLNWEKCHFMVKQGIVLGHVVSNRGIEVDKAKVDIISNLPPPKTVKDVRSFLGHAGF 396

Query: 4 H 2
+
Sbjct: 397 Y 397



Score = 67.4 bits (163), Expect(2) = 2e-28
Identities = 29/55 (52%), Positives = 38/55 (69%)
Frame = -3

Query: 534 DGFPTPFTKRVLEDVAGHVLYSFMDGFSGYNQLGIHLDDQGKTAFVTPWGMFIYK 370
D FP PF ++LE +AGH Y F+DG+SGYNQ+ I +DQ KT F P+G F Y+
Sbjct: 223 DHFPLPFIDQMLERLAGHEFYCFLDGYSGYNQIPIAPEDQEKTTFTCPYGTFAYR 277