BP911823
Clone id YMU001_000009_F01
Library
Length 545
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000009_F01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TATTACCTGCAGGTACGCGACTCCCCCAATGTGACACTATTCCCAACAGTGGCTGGAAGC
CAGCACCCTCTCATGCACGACCATGGTGGTCAAGGGCCATCCACCTCAACAAGGATGCAC
GGACCAGTCTGACAGGGGCCTCATTTTGTATTTTCTCACTTTCAGAAGCATTTGTAGCAT
TCTGAGAGGAGTATGCTGGTCGCACATACCTGTCCTGCATGACTTTTTTACACGCCTCCC
TGATCTTGATTCCACCATTCTAGTCCACAAGGACACATTTGACTATATTTTGCAATACAT
TTACTCATACATCACCAAGTACACGATGCCACTTCCCCCAGTAGTAGGCCTTTGGATGCC
ATGCAATATCCTGGTCTACATCCACAGAGGGGATCGACCATATCGGCAGTACCTAGCTCG
CTTCCAGGAGGTTGCTGCAGAGGCCGGGCACTGTGTAACTTTGGATGCCAACATGAGGAG
AGGGAAGTTAGGTACCACCTTCTTATCACGCCTGGCGACTTTTTTCTTCCTTCTCGCTGA
GAAAC
■■Homology search results ■■ -
sp_hit_id A4SHP4
Definition sp|A4SHP4|OTC_AERS4 Ornithine carbamoyltransferase OS=Aeromonas salmonicida (strain A449)
Align length 36
Score (bit) 32.7
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911823|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_F01.
(545 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A4SHP4|OTC_AERS4 Ornithine carbamoyltransferase OS=Aeromonas ... 33 1.2
sp|Q6CQB5|ERFB_KLULA Palmitoyltransferase ERF2 OS=Kluyveromyces ... 31 3.4
sp|Q10095|YAOG_SCHPO Uncharacterized protein C11D3.16c OS=Schizo... 30 7.6
sp|O74957|AGO1_SCHPO Protein argonaute OS=Schizosaccharomyces po... 30 7.6
sp|Q07954|LRP1_HUMAN Prolow-density lipoprotein receptor-related... 30 9.9

>sp|A4SHP4|OTC_AERS4 Ornithine carbamoyltransferase OS=Aeromonas
salmonicida (strain A449) GN=argF PE=3 SV=1
Length = 334

Score = 32.7 bits (73), Expect = 1.2
Identities = 14/36 (38%), Positives = 22/36 (61%)
Frame = +2

Query: 398 PYRQYLARFQEVAAEAGHCVTLDANMRRGKLGTTFL 505
P +A+ + +A E G C+TL +++ G LGT FL
Sbjct: 195 PEEDLVAKCRLIAEETGACITLTEDVKEGVLGTDFL 230


>sp|Q6CQB5|ERFB_KLULA Palmitoyltransferase ERF2 OS=Kluyveromyces
lactis GN=ERF2 PE=3 SV=1
Length = 355

Score = 31.2 bits (69), Expect = 3.4
Identities = 25/110 (22%), Positives = 45/110 (40%), Gaps = 18/110 (16%)
Frame = +2

Query: 140 LILYFLTFRSICSILRGVCWSHIPVLHDFFTRLPDLDSTILVHKDTFDYILQYIYSYITK 319
+ILY+ +ICS LR C P + +PDL+++ + ++ ++Y + +
Sbjct: 111 VILYYFYLLTICSFLRAACSD--PGIVPRNVHIPDLNASYKIPQEYYNYAILPTKNPNAS 168

Query: 320 YTMPLPPVVGLWMP--------CNILVYIHR----------GDRPYRQYL 415
+M +W P C++ V H G R YR +L
Sbjct: 169 VSMKYCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFL 218


>sp|Q10095|YAOG_SCHPO Uncharacterized protein C11D3.16c
OS=Schizosaccharomyces pombe GN=SPAC11D3.16c PE=2 SV=1
Length = 131

Score = 30.0 bits (66), Expect = 7.6
Identities = 27/97 (27%), Positives = 35/97 (36%), Gaps = 10/97 (10%)
Frame = +2

Query: 206 IPVLHDFFTRLPDLDSTIL--------VHK--DTFDYILQYIYSYITKYTMPLPPVVGLW 355
I LH T +P +L +HK D F YI QY + Y PLPPVV
Sbjct: 19 IEALHQRCTDIPRTQLCVLAISFNRFILHKSPDIFTYI-QYYQQKLNSYGFPLPPVVLKS 77

Query: 356 MPCNILVYIHRGDRPYRQYLARFQEVAAEAGHCVTLD 466
+ + D +R F A C +D
Sbjct: 78 LQMPLTSPEPDADERFRDGDTEFDTAGVTASSCFPVD 114


>sp|O74957|AGO1_SCHPO Protein argonaute OS=Schizosaccharomyces pombe
GN=ago1 PE=1 SV=1
Length = 834

Score = 30.0 bits (66), Expect = 7.6
Identities = 26/91 (28%), Positives = 36/91 (39%)
Frame = +2

Query: 203 HIPVLHDFFTRLPDLDSTILVHKDTFDYILQYIYSYITKYTMPLPPVVGLWMPCNILVYI 382
H VLHD PD T+ Y L Y+Y+ T +PPV + N
Sbjct: 745 HYTVLHDEIQMPPDQFQTLC-------YNLCYVYARATSAVSLVPPVYYAHLVSN----- 792

Query: 383 HRGDRPYRQYLARFQEVAAEAGHCVTLDANM 475
LAR+Q+V A+ T +A+M
Sbjct: 793 ----------LARYQDVTADDTFVETSEASM 813


>sp|Q07954|LRP1_HUMAN Prolow-density lipoprotein receptor-related
protein 1 OS=Homo sapiens GN=LRP1 PE=1 SV=1
Length = 4544

Score = 29.6 bits (65), Expect = 9.9
Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%)
Frame = -1

Query: 386 CGCRPGYCMASKGLLLGEVASC--TW*CMSKCIAKY-SQMCPC 267
C CRPG+ + G +V C T+ C +CI + S C C
Sbjct: 2965 CRCRPGFRLKDDGRTCADVDECSTTFPCSQRCINTHGSYKCLC 3007


tr_hit_id Q3KJM6
Definition tr|Q3KJM6|Q3KJM6_PSEPF Thioesterase, putative OS=Pseudomonas fluorescens (strain Pf0-1)
Align length 45
Score (bit) 37.7
E-value 0.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911823|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_F01.
(545 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q3KJM6|Q3KJM6_PSEPF Thioesterase, putative OS=Pseudomonas flu... 38 0.40
tr|B2BE96|B2BE96_CYDPO NADH dehydrogenase subunit 5 (Fragment) O... 35 3.4
tr|B1T6C9|B1T6C9_9BURK Putative uncharacterized protein OS=Burkh... 34 5.8
tr|B2BEA4|B2BEA4_PANHE NADH dehydrogenase subunit 5 (Fragment) O... 34 5.8
tr|B2BEA3|B2BEA3_CYDPO NADH dehydrogenase subunit 5 (Fragment) O... 34 5.8
tr|B2BEA2|B2BEA2_CYDPO NADH dehydrogenase subunit 5 (Fragment) O... 34 5.8
tr|B2BE90|B2BE90_CYDPO NADH dehydrogenase subunit 5 (Fragment) O... 34 5.8
tr|B2BE89|B2BE89_CYDPO NADH dehydrogenase subunit 5 (Fragment) O... 34 5.8
tr|B2BE88|B2BE88_CYDPO NADH dehydrogenase subunit 5 (Fragment) O... 34 5.8
tr|B2BE84|B2BE84_CYDPO NADH dehydrogenase subunit 5 (Fragment) O... 34 5.8
tr|B2BE81|B2BE81_CYDPO NADH dehydrogenase subunit 5 (Fragment) O... 34 5.8
tr|B2BE78|B2BE78_CYDPO NADH dehydrogenase subunit 5 (Fragment) O... 34 5.8
tr|B2BE77|B2BE77_CYDPO NADH dehydrogenase subunit 5 (Fragment) O... 34 5.8
tr|B2BE74|B2BE74_CYDPO NADH dehydrogenase subunit 5 (Fragment) O... 34 5.8
tr|B2BE72|B2BE72_CYDPO NADH dehydrogenase subunit 5 (Fragment) O... 34 5.8
tr|B2BE71|B2BE71_CYDPO NADH dehydrogenase subunit 5 (Fragment) O... 34 5.8
tr|B2BE70|B2BE70_CYDPO NADH dehydrogenase subunit 5 (Fragment) O... 34 5.8
tr|A8XYE2|A8XYE2_CAEBR Putative uncharacterized protein OS=Caeno... 34 5.8
tr|B3M4M5|B3M4M5_DROAN GF25303 OS=Drosophila ananassae GN=GF2530... 33 7.6
tr|B2BE83|B2BE83_CYDPO NADH dehydrogenase subunit 5 (Fragment) O... 33 7.6
tr|Q99533|Q99533_HUMAN Alpha3A (Fragment) OS=Homo sapiens GN=LAM... 33 7.6
tr|Q6VU69|Q6VU69_HUMAN Laminin alpha 3 splice variant a OS=Homo ... 33 7.6
tr|B0YJ33|B0YJ33_HUMAN Laminin alpha-3 chain variant 2 OS=Homo s... 33 7.6
tr|A4JLF9|A4JLF9_BURVG Putative uncharacterized protein OS=Burkh... 33 9.9
tr|Q9NJS6|Q9NJS6_APLKU Octopamine receptor OS=Aplysia kurodai PE... 33 9.9
tr|Q9NHF3|Q9NHF3_APLCA Octopamine receptor OS=Aplysia californic... 33 9.9

>tr|Q3KJM6|Q3KJM6_PSEPF Thioesterase, putative OS=Pseudomonas
fluorescens (strain Pf0-1) GN=Pf01_0286 PE=4 SV=1
Length = 151

Score = 37.7 bits (86), Expect = 0.40
Identities = 17/45 (37%), Positives = 29/45 (64%), Gaps = 2/45 (4%)
Frame = -3

Query: 489 NFPLLMLASKVTQCPASAATSWKR--ARYCRYGRSPLWM*TRILH 361
++PL + + CP+ +AT WK+ A Y RYGR+ L + TR+++
Sbjct: 89 SYPLPVTGDAIAICPSPSATQWKKFLAMYQRYGRARLTLHTRVVN 133


>tr|B2BE96|B2BE96_CYDPO NADH dehydrogenase subunit 5 (Fragment)
OS=Cydia pomonella GN=ND5 PE=4 SV=1
Length = 309

Score = 34.7 bits (78), Expect = 3.4
Identities = 19/62 (30%), Positives = 33/62 (53%)
Frame = +2

Query: 137 GLILYFLTFRSICSILRGVCWSHIPVLHDFFTRLPDLDSTILVHKDTFDYILQYIYSYIT 316
G I Y+L F S+C + + IP L F+++ L+ L + + F ++L YI + +T
Sbjct: 115 GGISYYLPFTSLCLNISNMALCGIPFLAGFYSKDMILELVSLSYLNMFIFLLYYISTGLT 174

Query: 317 KY 322
Y
Sbjct: 175 MY 176


>tr|B1T6C9|B1T6C9_9BURK Putative uncharacterized protein
OS=Burkholderia ambifaria MEX-5 GN=BamMEX5DRAFT_3345
PE=3 SV=1
Length = 547

Score = 33.9 bits (76), Expect = 5.8
Identities = 19/58 (32%), Positives = 28/58 (48%)
Frame = +2

Query: 170 ICSILRGVCWSHIPVLHDFFTRLPDLDSTILVHKDTFDYILQYIYSYITKYTMPLPPV 343
IC IL + ++ PV H RL DLD+ + + Y+YS K+TM P+
Sbjct: 241 ICDILHDILQTNAPVNHRALVRLEDLDA--YTTTSSMKQLTDYLYSKQIKFTMATIPL 296


>tr|B2BEA4|B2BEA4_PANHE NADH dehydrogenase subunit 5 (Fragment)
OS=Pandemis heparana GN=ND5 PE=4 SV=1
Length = 309

Score = 33.9 bits (76), Expect = 5.8
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = +2

Query: 137 GLILYFLTFRSICSILRGVCWSHIPVLHDFFTRLPDLDSTILVHKDTFDYILQYIYSYIT 316
G I Y+L F S+C + + IP L F+++ L+ L + + F + L YI + +T
Sbjct: 115 GGISYYLPFTSLCLNISNMALCGIPFLAGFYSKDMILELVSLSYLNMFIFFLYYISTGLT 174

Query: 317 KY 322
Y
Sbjct: 175 MY 176


>tr|B2BEA3|B2BEA3_CYDPO NADH dehydrogenase subunit 5 (Fragment)
OS=Cydia pomonella GN=ND5 PE=4 SV=1
Length = 309

Score = 33.9 bits (76), Expect = 5.8
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = +2

Query: 137 GLILYFLTFRSICSILRGVCWSHIPVLHDFFTRLPDLDSTILVHKDTFDYILQYIYSYIT 316
G I Y+L F S+C + + IP L F+++ L+ L + + F + L YI + +T
Sbjct: 115 GGISYYLPFTSLCLNISNMALCGIPFLAGFYSKDMILELVSLSYLNMFIFFLYYISTGLT 174

Query: 317 KY 322
Y
Sbjct: 175 MY 176


>tr|B2BEA2|B2BEA2_CYDPO NADH dehydrogenase subunit 5 (Fragment)
OS=Cydia pomonella GN=ND5 PE=4 SV=1
Length = 309

Score = 33.9 bits (76), Expect = 5.8
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = +2

Query: 137 GLILYFLTFRSICSILRGVCWSHIPVLHDFFTRLPDLDSTILVHKDTFDYILQYIYSYIT 316
G I Y+L F S+C + + IP L F+++ L+ L + + F + L YI + +T
Sbjct: 115 GGISYYLPFTSLCLNISNMALCGIPFLAGFYSKDMILELVSLSYLNMFIFFLYYISTGLT 174

Query: 317 KY 322
Y
Sbjct: 175 MY 176


>tr|B2BE90|B2BE90_CYDPO NADH dehydrogenase subunit 5 (Fragment)
OS=Cydia pomonella GN=ND5 PE=4 SV=1
Length = 309

Score = 33.9 bits (76), Expect = 5.8
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = +2

Query: 137 GLILYFLTFRSICSILRGVCWSHIPVLHDFFTRLPDLDSTILVHKDTFDYILQYIYSYIT 316
G I Y+L F S+C + + IP L F+++ L+ L + + F + L YI + +T
Sbjct: 115 GGISYYLPFTSLCLNISNMALCGIPFLAGFYSKDMILELVSLSYLNMFIFFLYYISTGLT 174

Query: 317 KY 322
Y
Sbjct: 175 MY 176


>tr|B2BE89|B2BE89_CYDPO NADH dehydrogenase subunit 5 (Fragment)
OS=Cydia pomonella GN=ND5 PE=4 SV=1
Length = 309

Score = 33.9 bits (76), Expect = 5.8
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = +2

Query: 137 GLILYFLTFRSICSILRGVCWSHIPVLHDFFTRLPDLDSTILVHKDTFDYILQYIYSYIT 316
G I Y+L F S+C + + IP L F+++ L+ L + + F + L YI + +T
Sbjct: 115 GGISYYLPFTSLCLNISNMALCGIPFLAGFYSKDMILELVSLSYLNMFIFFLYYISTGLT 174

Query: 317 KY 322
Y
Sbjct: 175 MY 176


>tr|B2BE88|B2BE88_CYDPO NADH dehydrogenase subunit 5 (Fragment)
OS=Cydia pomonella GN=ND5 PE=4 SV=1
Length = 308

Score = 33.9 bits (76), Expect = 5.8
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = +2

Query: 137 GLILYFLTFRSICSILRGVCWSHIPVLHDFFTRLPDLDSTILVHKDTFDYILQYIYSYIT 316
G I Y+L F S+C + + IP L F+++ L+ L + + F + L YI + +T
Sbjct: 114 GGISYYLPFTSLCLNISNMALCGIPFLAGFYSKDMILELVSLSYLNMFIFFLYYISTGLT 173

Query: 317 KY 322
Y
Sbjct: 174 MY 175


>tr|B2BE84|B2BE84_CYDPO NADH dehydrogenase subunit 5 (Fragment)
OS=Cydia pomonella GN=ND5 PE=4 SV=1
Length = 309

Score = 33.9 bits (76), Expect = 5.8
Identities = 19/62 (30%), Positives = 32/62 (51%)
Frame = +2

Query: 137 GLILYFLTFRSICSILRGVCWSHIPVLHDFFTRLPDLDSTILVHKDTFDYILQYIYSYIT 316
G I Y+L F S+C + + IP L F+++ L+ L + + F + L YI + +T
Sbjct: 115 GGISYYLPFTSLCLNISNMALCGIPFLAGFYSKDMILELVSLSYLNMFIFFLYYISTGLT 174

Query: 317 KY 322
Y
Sbjct: 175 MY 176