BP911848
Clone id YMU001_000009_H04
Library
Length 372
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000009_H04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AAATCTCATCCCGAAATGGTAGAGGGTAGTGATTCCGCTTGTTCACAACATTCAAAGGTT
TATAGTCTGCACATACTCACCATTTTCCATTCTTCTTTGGGGTAATGACAACAGGAGAAA
CCCACTCAGACTCTTTCTCTGGATGTATAATACCTGCCTTGAGCAACTTGTTGATCTCCT
GCCATAGAGCCTCCATCAGAATATCTCCCAACCTCCTTAGCTTCTGTGCTTTTGGCCTGT
ATCCATCCTTAAGTAGGATCCAGTGCTCCACTCCTTTAGCTCATCTAAGATCTACTCTGT
TGGAAATAGTTCGGGATAAGATGAACATAGGTCCATATAGCCCTCCTTTTCCTGCTTGTG
CTAGGTCTGTAC
■■Homology search results ■■ -
sp_hit_id Q9UR07
Definition sp|Q9UR07|RTF23_SCHPO Retrotransposable element Tf2 155 kDa protein type 3 OS=Schizosaccharomyces pombe
Align length 65
Score (bit) 52.4
E-value 7.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911848|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_H04.
(372 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9UR07|RTF23_SCHPO Retrotransposable element Tf2 155 kDa prot... 52 7e-07
sp|Q9C0R2|RTF22_SCHPO Retrotransposable element Tf2 155 kDa prot... 52 7e-07
sp|Q05654|RTF21_SCHPO Retrotransposable element Tf2 155 kDa prot... 52 7e-07
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorha... 50 5e-06
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Sa... 47 3e-05
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Sa... 47 3e-05
sp|Q9WJR5|POK3_HUMAN HERV-K_19q12 provirus ancestral Pol protein... 40 0.003
sp|P11368|POL_IPMA Putative Pol polyprotein OS=Mouse intracister... 40 0.004
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from tra... 40 0.004
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=p... 40 0.005
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from tra... 39 0.010
sp|P63133|POK6_HUMAN HERV-K_8p23.1 provirus ancestral Pol protei... 38 0.014
sp|P63132|POK5_HUMAN HERV-K_19p13.11 provirus ancestral Pol prot... 38 0.014
sp|P63128|POK4_HUMAN HERV-K_6q14.1 provirus ancestral Gag-Pol po... 38 0.014
sp|Q9BXR3|POK2_HUMAN HERV-K_7p22.1 provirus ancestral Pol protei... 38 0.014
sp|Q9UQG0|POK20_HUMAN HERV-K_3q27.3 provirus ancestral Pol prote... 38 0.014
sp|P63136|POK17_HUMAN HERV-K_11q22.1 provirus ancestral Pol prot... 38 0.014
sp|P63135|POK12_HUMAN HERV-K_1q22 provirus ancestral Pol protein... 38 0.014
sp|P87893|POK11_HUMAN HERV-K_22q11.21 provirus ancestral Pol pro... 38 0.014
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from tra... 38 0.018
sp|P63134|POK9_HUMAN HERV-K_5q13.3 provirus ancestral Pol protei... 38 0.018
sp|P10266|POK10_HUMAN HERV-K_5q33.3 provirus ancestral Pol prote... 38 0.018
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus... 37 0.031
sp|P16088|POL_FIVPE Pol polyprotein OS=Feline immunodeficiency v... 37 0.040
sp|P19028|POL_FIVSD Pol polyprotein OS=Feline immunodeficiency v... 36 0.068
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from tra... 36 0.068
sp|Q9QC07|POK7_HUMAN HERV-K_1q23.3 provirus ancestral Pol protei... 36 0.068
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus ty... 35 0.089
sp|P11283|POL_MMTVC Pol polyprotein (Fragment) OS=Mouse mammary ... 35 0.089
sp|P03365|POL_MMTVB Pol polyprotein OS=Mouse mammary tumor virus... 35 0.089

>sp|Q9UR07|RTF23_SCHPO Retrotransposable element Tf2 155 kDa protein
type 3 OS=Schizosaccharomyces pombe GN=Tf2-11 PE=4 SV=1
Length = 1333

Score = 52.4 bits (124), Expect = 7e-07
Identities = 29/65 (44%), Positives = 38/65 (58%)
Frame = -3

Query: 196 MEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNGKW*VCADYKPLNVVNKRNHYPLP 17
M+A+ EIN+ LK+GII K PV+ PKK G + DYKPLN K N YPLP
Sbjct: 425 MQAMNDEINQGLKSGIIRESKAIN-ACPVMFVPKKEGTLRMVVDYKPLNKYVKPNIYPLP 483

Query: 16 FRDEI 2
+++
Sbjct: 484 LIEQL 488


>sp|Q9C0R2|RTF22_SCHPO Retrotransposable element Tf2 155 kDa protein
type 2 OS=Schizosaccharomyces pombe GN=Tf2-7 PE=2 SV=1
Length = 1333

Score = 52.4 bits (124), Expect = 7e-07
Identities = 29/65 (44%), Positives = 38/65 (58%)
Frame = -3

Query: 196 MEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNGKW*VCADYKPLNVVNKRNHYPLP 17
M+A+ EIN+ LK+GII K PV+ PKK G + DYKPLN K N YPLP
Sbjct: 425 MQAMNDEINQGLKSGIIRESKAIN-ACPVMFVPKKEGTLRMVVDYKPLNKYVKPNIYPLP 483

Query: 16 FRDEI 2
+++
Sbjct: 484 LIEQL 488


>sp|Q05654|RTF21_SCHPO Retrotransposable element Tf2 155 kDa protein
type 1 OS=Schizosaccharomyces pombe GN=Tf2-1 PE=2 SV=1
Length = 1333

Score = 52.4 bits (124), Expect = 7e-07
Identities = 29/65 (44%), Positives = 38/65 (58%)
Frame = -3

Query: 196 MEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNGKW*VCADYKPLNVVNKRNHYPLP 17
M+A+ EIN+ LK+GII K PV+ PKK G + DYKPLN K N YPLP
Sbjct: 425 MQAMNDEINQGLKSGIIRESKAIN-ACPVMFVPKKEGTLRMVVDYKPLNKYVKPNIYPLP 483

Query: 16 FRDEI 2
+++
Sbjct: 484 LIEQL 488


>sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6
OS=Caenorhabditis elegans GN=K02A2.6 PE=2 SV=1
Length = 1268

Score = 49.7 bits (117), Expect = 5e-06
Identities = 27/68 (39%), Positives = 42/68 (61%), Gaps = 3/68 (4%)
Frame = -3

Query: 196 MEALWQEINKLLKAGIIHPEKESEWVSPVVITPKK-NGKW*VCADYK--PLNVVNKRNHY 26
+EA+ E+N+L + G+I P ++W +P+V+ KK GK VCAD+K LN K +
Sbjct: 453 LEAVETELNRLQEMGVIVPITYAKWAAPIVVIKKKGTGKIRVCADFKCSGLNAALKDEFH 512

Query: 25 PLPFRDEI 2
PLP ++I
Sbjct: 513 PLPTSEDI 520


>sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY3B-I PE=3 SV=2
Length = 1498

Score = 47.0 bits (110), Expect = 3e-05
Identities = 37/95 (38%), Positives = 49/95 (51%), Gaps = 5/95 (5%)
Frame = -3

Query: 271 VEHWILLKDGYR-PKAQKLRRLGDILMEALWQEINK----LLKAGIIHPEKESEWVSPVV 107
V+H I +K G R P+ Q + E QEINK LL I P K S SPVV
Sbjct: 610 VKHDIEIKPGARLPRLQPYH-----VTEKNEQEINKIVQKLLDNKFIVPSK-SPCSSPVV 663

Query: 106 ITPKKNGKW*VCADYKPLNVVNKRNHYPLPFRDEI 2
+ PKK+G + +C DY+ LN + +PLP D +
Sbjct: 664 LVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNL 698


>sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY3B-G PE=1 SV=3
Length = 1547

Score = 47.0 bits (110), Expect = 3e-05
Identities = 37/95 (38%), Positives = 49/95 (51%), Gaps = 5/95 (5%)
Frame = -3

Query: 271 VEHWILLKDGYR-PKAQKLRRLGDILMEALWQEINK----LLKAGIIHPEKESEWVSPVV 107
V+H I +K G R P+ Q + E QEINK LL I P K S SPVV
Sbjct: 584 VKHDIEIKPGARLPRLQPYH-----VTEKNEQEINKIVQKLLDNKFIVPSK-SPCSSPVV 637

Query: 106 ITPKKNGKW*VCADYKPLNVVNKRNHYPLPFRDEI 2
+ PKK+G + +C DY+ LN + +PLP D +
Sbjct: 638 LVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNL 672


>sp|Q9WJR5|POK3_HUMAN HERV-K_19q12 provirus ancestral Pol protein
OS=Homo sapiens GN=ERVK6 PE=2 SV=2
Length = 959

Score = 40.4 bits (93), Expect = 0.003
Identities = 22/52 (42%), Positives = 30/52 (57%)
Frame = -3

Query: 196 MEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNGKW*VCADYKPLNVVN 41
+EAL N+ L+ G I P S W SPV + KK+GKW + D + +N VN
Sbjct: 46 LEALHLLANEQLEKGHIEPSF-SPWNSPVFVIQKKSGKWRMLTDLRAVNAVN 96


>sp|P11368|POL_IPMA Putative Pol polyprotein OS=Mouse intracisternal
a-particle MIA14 GN=pol PE=3 SV=1
Length = 867

Score = 40.0 bits (92), Expect = 0.004
Identities = 19/49 (38%), Positives = 30/49 (61%)
Frame = -3

Query: 196 MEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNGKW*VCADYKPLN 50
+EA+ Q + + LK G I P S W +P+ + KK+GKW + D +P+N
Sbjct: 41 LEAVIQLVEEQLKLGHIDPST-SPWNTPIFVIKKKSGKWRLLHDLRPIN 88


>sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from
transposon 412 OS=Drosophila melanogaster GN=POL PE=4
SV=1
Length = 1237

Score = 40.0 bits (92), Expect = 0.004
Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 6/71 (8%)
Frame = -3

Query: 196 MEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNG------KW*VCADYKPLNVVNKR 35
+E + ++ KL+K I+ P S++ SP+++ PKK+ KW + DY+ +N
Sbjct: 327 VEEIQAQVQKLIKDKIVEPSV-SQYNSPLLLVPKKSSPNSDKKKWRLVIDYRQINKKLLA 385

Query: 34 NHYPLPFRDEI 2
+ +PLP D+I
Sbjct: 386 DKFPLPRIDDI 396


>sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol
PE=3 SV=1
Length = 1156

Score = 39.7 bits (91), Expect = 0.005
Identities = 23/65 (35%), Positives = 34/65 (52%)
Frame = -3

Query: 238 RPKAQKLRRLGDILMEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNGKW*VCADYK 59
+P QK + + IN LLK G++ +KES +PV PK NG+W + DY+
Sbjct: 158 KPTPQKQYHINPKAKPDIQIVINDLLKQGVLI-QKESTMNTPVYPVPKPNGRWRMVLDYR 216

Query: 58 PLNVV 44
+N V
Sbjct: 217 AVNKV 221


tr_hit_id A5C086
Definition tr|A5C086|A5C086_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 106
Score (bit) 84.0
E-value 3.0e-15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911848|Adiantum capillus-veneris mRNA, clone:
YMU001_000009_H04.
(372 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5C086|A5C086_VITVI Putative uncharacterized protein OS=Vitis... 84 3e-15
tr|A5C084|A5C084_VITVI Putative uncharacterized protein OS=Vitis... 84 3e-15
tr|A5B854|A5B854_VITVI Putative uncharacterized protein OS=Vitis... 84 3e-15
tr|A5AH70|A5AH70_VITVI Putative uncharacterized protein OS=Vitis... 84 3e-15
tr|A5BWF3|A5BWF3_VITVI Putative uncharacterized protein OS=Vitis... 83 6e-15
tr|A5B436|A5B436_VITVI Putative uncharacterized protein OS=Vitis... 83 6e-15
tr|A7QJX4|A7QJX4_VITVI Chromosome undetermined scaffold_108, who... 82 1e-14
tr|A5C265|A5C265_VITVI Putative uncharacterized protein OS=Vitis... 82 1e-14
tr|A5AHC9|A5AHC9_VITVI Putative uncharacterized protein OS=Vitis... 82 1e-14
tr|A5AGJ4|A5AGJ4_VITVI Putative uncharacterized protein OS=Vitis... 82 1e-14
tr|Q7X639|Q7X639_ORYSJ OSJNBb0067G11.5 protein OS=Oryza sativa s... 82 1e-14
tr|A5CAG9|A5CAG9_VITVI Putative uncharacterized protein OS=Vitis... 82 1e-14
tr|A5C277|A5C277_VITVI Putative uncharacterized protein OS=Vitis... 82 1e-14
tr|A5BJD2|A5BJD2_VITVI Putative uncharacterized protein OS=Vitis... 82 1e-14
tr|A7QRS4|A7QRS4_VITVI Chromosome chr13 scaffold_152, whole geno... 82 2e-14
tr|A5BP18|A5BP18_VITVI Putative uncharacterized protein OS=Vitis... 82 2e-14
tr|A5AYI6|A5AYI6_VITVI Putative uncharacterized protein OS=Vitis... 82 2e-14
tr|Q2QWR1|Q2QWR1_ORYSJ Retrotransposon protein, putative, unclas... 81 2e-14
tr|A7QRX1|A7QRX1_VITVI Chromosome undetermined scaffold_153, who... 81 2e-14
tr|A5C8W6|A5C8W6_VITVI Putative uncharacterized protein OS=Vitis... 81 2e-14
tr|A5BXP9|A5BXP9_VITVI Putative uncharacterized protein OS=Vitis... 81 2e-14
tr|A5BWK7|A5BWK7_VITVI Putative uncharacterized protein OS=Vitis... 81 2e-14
tr|A5BJ17|A5BJ17_VITVI Putative uncharacterized protein OS=Vitis... 81 2e-14
tr|A5B7S7|A5B7S7_VITVI Putative uncharacterized protein OS=Vitis... 81 2e-14
tr|A7R543|A7R543_VITVI Chromosome undetermined scaffold_864, who... 81 3e-14
tr|A5C2R0|A5C2R0_VITVI Putative uncharacterized protein OS=Vitis... 81 3e-14
tr|A5BZQ8|A5BZQ8_VITVI Putative uncharacterized protein OS=Vitis... 81 3e-14
tr|A5BXM1|A5BXM1_VITVI Putative uncharacterized protein OS=Vitis... 81 3e-14
tr|A5BW26|A5BW26_VITVI Putative uncharacterized protein OS=Vitis... 81 3e-14
tr|A5BJ75|A5BJ75_VITVI Putative uncharacterized protein OS=Vitis... 81 3e-14

>tr|A5C086|A5C086_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_036087 PE=4 SV=1
Length = 1418

Score = 84.0 bits (206), Expect = 3e-15
Identities = 41/106 (38%), Positives = 60/106 (56%), Gaps = 18/106 (16%)
Frame = -3

Query: 265 HWILLKDGYRPKAQKLRRLGDILMEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNG 86
H I +++G +P Q RRL + E + E+ KLL+AGII+P +S WVSP + PKK+G
Sbjct: 821 HHIYMEEGAKPTRQPQRRLNPHMQEVVRAEVLKLLQAGIIYPISDSAWVSPTQVVPKKSG 880

Query: 85 ------------------KW*VCADYKPLNVVNKRNHYPLPFRDEI 2
W VC DY+ LN V +++H+PLPF D++
Sbjct: 881 ITVVKGENGDEVSTRLTTGWRVCIDYRKLNAVTRKDHFPLPFMDQV 926


>tr|A5C084|A5C084_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_036085 PE=4 SV=1
Length = 797

Score = 84.0 bits (206), Expect = 3e-15
Identities = 41/106 (38%), Positives = 60/106 (56%), Gaps = 18/106 (16%)
Frame = -3

Query: 265 HWILLKDGYRPKAQKLRRLGDILMEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNG 86
H I +++G +P Q RRL + E + E+ KLL+AGII+P +S WVSP + PKK+G
Sbjct: 395 HHIYMEEGAKPTRQPQRRLNPHMQEVVRAEVLKLLQAGIIYPISDSAWVSPTQVVPKKSG 454

Query: 85 ------------------KW*VCADYKPLNVVNKRNHYPLPFRDEI 2
W VC DY+ LN V +++H+PLPF D++
Sbjct: 455 ITVVKGENGDEVSTRLTTGWRVCIDYRKLNAVTRKDHFPLPFMDQV 500


>tr|A5B854|A5B854_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_003321 PE=4 SV=1
Length = 879

Score = 84.0 bits (206), Expect = 3e-15
Identities = 41/106 (38%), Positives = 60/106 (56%), Gaps = 18/106 (16%)
Frame = -3

Query: 265 HWILLKDGYRPKAQKLRRLGDILMEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNG 86
H I +++G +P Q RRL + E + E+ KLL+AGII+P +S WVSP + PKK+G
Sbjct: 100 HHIYMEEGAKPTRQPQRRLNPHMQEVVRAEVLKLLQAGIIYPISDSTWVSPTQVVPKKSG 159

Query: 85 ------------------KW*VCADYKPLNVVNKRNHYPLPFRDEI 2
W VC DY+ LN V +++H+PLPF D++
Sbjct: 160 ITVVKGENGDEVSTRLTTGWRVCIDYRKLNAVTRKDHFPLPFMDQV 205


>tr|A5AH70|A5AH70_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_032754 PE=4 SV=1
Length = 2203

Score = 84.0 bits (206), Expect = 3e-15
Identities = 41/106 (38%), Positives = 60/106 (56%), Gaps = 18/106 (16%)
Frame = -3

Query: 265 HWILLKDGYRPKAQKLRRLGDILMEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNG 86
H I +++G +P Q RRL + E + E+ KLL+AGII+P +S WVSP + PKK+G
Sbjct: 929 HHIYMEEGAKPTXQPQRRLNPHMQEVVRAEVLKLLQAGIIYPISDSTWVSPTQVVPKKSG 988

Query: 85 ------------------KW*VCADYKPLNVVNKRNHYPLPFRDEI 2
W VC DY+ LN V +++H+PLPF D++
Sbjct: 989 ITVVKGENGDEVSTRLTTGWRVCIDYRKLNTVTRKDHFPLPFMDQV 1034


>tr|A5BWF3|A5BWF3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_003421 PE=4 SV=1
Length = 1924

Score = 83.2 bits (204), Expect = 6e-15
Identities = 43/106 (40%), Positives = 60/106 (56%), Gaps = 18/106 (16%)
Frame = -3

Query: 265 HWILLKDGYRPKAQKLRRLGDILMEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNG 86
H I +++ +P Q RRL L E + E+ KLLKAGII+P +S WVSP + PKK+G
Sbjct: 1024 HHIYMEEEAKPIRQPQRRLNPHLQEVVRTEVLKLLKAGIIYPISDSPWVSPTQVVPKKSG 1083

Query: 85 ------------------KW*VCADYKPLNVVNKRNHYPLPFRDEI 2
W VC DY+ LNVV +++H+PLPF D++
Sbjct: 1084 ITVVQNEKGEEIATRLASGWRVCIDYRKLNVVTRKDHFPLPFIDQV 1129


>tr|A5B436|A5B436_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_016516 PE=4 SV=1
Length = 1656

Score = 83.2 bits (204), Expect = 6e-15
Identities = 42/106 (39%), Positives = 59/106 (55%), Gaps = 18/106 (16%)
Frame = -3

Query: 265 HWILLKDGYRPKAQKLRRLGDILMEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNG 86
H I +++ +P Q RRL L E + E+ KLL+AGII+P +S WVSP + PKK+G
Sbjct: 863 HHIYMEEEAKPIRQPQRRLNPYLQEVVLAEVLKLLQAGIIYPISDSPWVSPTQVVPKKSG 922

Query: 85 ------------------KW*VCADYKPLNVVNKRNHYPLPFRDEI 2
W VC DY+ LN V ++NH+PLPF D++
Sbjct: 923 ITVVQNEKGEEITTRLTLGWRVCIDYRKLNAVTRKNHFPLPFIDQV 968


>tr|A7QJX4|A7QJX4_VITVI Chromosome undetermined scaffold_108, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00000833001 PE=4 SV=1
Length = 1615

Score = 82.4 bits (202), Expect = 1e-14
Identities = 41/106 (38%), Positives = 60/106 (56%), Gaps = 18/106 (16%)
Frame = -3

Query: 265 HWILLKDGYRPKAQKLRRLGDILMEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNG 86
H I ++D +P Q RRL + E + E+ KLL+AGII+P +S WVSP + PKK+G
Sbjct: 715 HHIYMEDDAKPVRQPQRRLNPHMQEVVRSEVLKLLQAGIIYPISDSLWVSPTQVVPKKSG 774

Query: 85 ------------------KW*VCADYKPLNVVNKRNHYPLPFRDEI 2
+W VC DY+ LN V +++H+PLPF D++
Sbjct: 775 ITVIQNEKGEEVSTRPTSRWRVCIDYRRLNSVTRKDHFPLPFMDQV 820


>tr|A5C265|A5C265_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_009564 PE=4 SV=1
Length = 2225

Score = 82.4 bits (202), Expect = 1e-14
Identities = 40/106 (37%), Positives = 59/106 (55%), Gaps = 18/106 (16%)
Frame = -3

Query: 265 HWILLKDGYRPKAQKLRRLGDILMEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNG 86
H I +++G +P Q RRL + E + E+ KLL+ GII+P +S WVSP + PKK+G
Sbjct: 1281 HHIYMEEGAKPTRQPQRRLNPHMQEVVRAEVLKLLQVGIIYPISDSTWVSPTQVVPKKSG 1340

Query: 85 ------------------KW*VCADYKPLNVVNKRNHYPLPFRDEI 2
W VC DY+ LN V +++H+PLPF D++
Sbjct: 1341 ITVVKGENGDEVSTRLTTGWRVCIDYRKLNAVTRKDHFPLPFMDQV 1386


>tr|A5AHC9|A5AHC9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_010501 PE=4 SV=1
Length = 2107

Score = 82.4 bits (202), Expect = 1e-14
Identities = 42/106 (39%), Positives = 60/106 (56%), Gaps = 18/106 (16%)
Frame = -3

Query: 265 HWILLKDGYRPKAQKLRRLGDILMEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNG 86
H I +++ +P Q RRL L E + E+ KLL+AGII+P +S WVSP + PKK+G
Sbjct: 1310 HHIYMEEEAKPIHQPQRRLNPHLQEVVRAEVLKLLQAGIIYPISDSSWVSPTQVVPKKSG 1369

Query: 85 ------------------KW*VCADYKPLNVVNKRNHYPLPFRDEI 2
W VC DY+ LNVV +++H+PLPF D++
Sbjct: 1370 IIVVQNENGEEIATCLTSSWRVCIDYRKLNVVTRKDHFPLPFIDQV 1415


>tr|A5AGJ4|A5AGJ4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_009750 PE=4 SV=1
Length = 1013

Score = 82.4 bits (202), Expect = 1e-14
Identities = 43/106 (40%), Positives = 59/106 (55%), Gaps = 18/106 (16%)
Frame = -3

Query: 265 HWILLKDGYRPKAQKLRRLGDILMEALWQEINKLLKAGIIHPEKESEWVSPVVITPKKNG 86
H I +++ +P Q RRL L E + E+ KLL+AGII+P +S WVSP + PKK+G
Sbjct: 882 HHIYMEEEAKPIRQPQRRLNPHLQEVVQTEVLKLLQAGIIYPISDSPWVSPTQVVPKKSG 941

Query: 85 ------------------KW*VCADYKPLNVVNKRNHYPLPFRDEI 2
W VC DYK LNVV ++ H+PLPF D++
Sbjct: 942 ITVVQNEKGEEIXTRLTSGWRVCIDYKKLNVVTRKXHFPLPFIDQV 987