BP911859
Clone id YMU001_000010_A10
Library
Length 266
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000010_A10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATAACGAGGCGTATTGTAAACAGAATGAGTACACCTGTTCCATGTCAGCGTAATATGGGT
TTTACAGCCCACTCCCGCTCTTTTCTCTTCATCCTTGCTTGCATCTTGTCGAACTTTTCT
TGACCCTTCTCAACCAAAAGATCATAAAGAACGTATTGCTCAGGGTCGTCATTCCGGGCC
ATCTCATCCCTTTTCCCTTTTGCTGAATTGAATACCAAACGATGTGTTAGCCATCCAGAG
TCATCATCTTCTGCAGCGCTGACGTC
■■Homology search results ■■ -
sp_hit_id P0C1J2
Definition sp|P0C1J2|CWC27_RHIOR Peptidyl-prolyl isomerase cwc27 OS=Rhizopus oryzae
Align length 40
Score (bit) 34.7
E-value 0.15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911859|Adiantum capillus-veneris mRNA, clone:
YMU001_000010_A10.
(266 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P0C1J2|CWC27_RHIOR Peptidyl-prolyl isomerase cwc27 OS=Rhizopu... 35 0.15
sp|Q6GLX7|SDC10_XENLA Peptidyl-prolyl cis-trans isomerase SDCCAG... 33 0.45
sp|Q17QX9|SDC10_BOVIN Peptidyl-prolyl cis-trans isomerase SDCCAG... 32 0.76
sp|Q4IPB3|CWC27_GIBZE Peptidyl-prolyl isomerase CWC27 OS=Gibbere... 32 0.76
sp|Q7ZW86|SDC10_DANRE Peptidyl-prolyl cis-trans isomerase SDCCAG... 32 1.00
sp|A0JP80|FIT2_XENTR Protein FIT2 homolog OS=Xenopus tropicalis ... 31 2.2
sp|Q5R7W3|SDC10_PONAB Peptidyl-prolyl cis-trans isomerase SDCCAG... 30 2.9
sp|Q4R713|SDC10_MACFA Peptidyl-prolyl cis-trans isomerase SDCCAG... 30 2.9
sp|Q6UX04|SDC10_HUMAN Peptidyl-prolyl cis-trans isomerase SDCCAG... 30 2.9
sp|Q5F450|PAN2_CHICK PAB-dependent poly(A)-specific ribonuclease... 30 2.9
sp|Q7SBX8|CWC27_NEUCR Peptidyl-prolyl isomerase cwc-27 OS=Neuros... 30 2.9
sp|Q9BWV7|TTLL2_HUMAN Probable tubulin polyglutamylase TTLL2 OS=... 30 3.8
sp|Q5XIB2|SDC10_RAT Peptidyl-prolyl cis-trans isomerase SDCCAG10... 30 3.8
sp|Q3TKY6|SDC10_MOUSE Peptidyl-prolyl cis-trans isomerase SDCCAG... 30 3.8
sp|Q98630|VP3_RDVF Major 114 kDa structural protein OS=Rice dwar... 29 8.5
sp|A5N4P0|RPOC_CLOK5 DNA-directed RNA polymerase subunit beta' O... 29 8.5

>sp|P0C1J2|CWC27_RHIOR Peptidyl-prolyl isomerase cwc27 OS=Rhizopus
oryzae GN=cwc27 PE=3 SV=1
Length = 524

Score = 34.7 bits (78), Expect = 0.15
Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 2/40 (5%)
Frame = -1

Query: 254 AEDD--DSGWLTHRLVFNSAKGKRDEMARNDDPEQYVLYD 141
AE+D D+GW++H+L+F +D M R + + YV+ D
Sbjct: 422 AEEDVSDAGWISHKLIFEKDLKGKDLMKRRETVDDYVVID 461


>sp|Q6GLX7|SDC10_XENLA Peptidyl-prolyl cis-trans isomerase SDCCAG10
OS=Xenopus laevis GN=sdccag10 PE=2 SV=1
Length = 477

Score = 33.1 bits (74), Expect = 0.45
Identities = 17/58 (29%), Positives = 31/58 (53%)
Frame = -1

Query: 251 EDDDSGWLTHRLVFNSAKGKRDEMARNDDPEQYVLYDLLVEKGQEKFDKMQARMKRKE 78
E++D GWL+H L F GK + A D + + +YD + + ++ + MK+K+
Sbjct: 418 EENDKGWLSHVLQFEEKSGKVKD-ANMQDEDTFEIYDPRNPVNKRRREESKKIMKQKK 474


>sp|Q17QX9|SDC10_BOVIN Peptidyl-prolyl cis-trans isomerase SDCCAG10
OS=Bos taurus GN=SDCCAG10 PE=2 SV=1
Length = 473

Score = 32.3 bits (72), Expect = 0.76
Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 3/67 (4%)
Frame = -1

Query: 266 DVSAAE-DDDSGWLTHRLVFNSAKGKRDEMARNDDPEQYVLYDLL--VEKGQEKFDKMQA 96
D+S E +DD GW++H L F K ++ + A D + + +YD V K + + K
Sbjct: 408 DISETEVEDDEGWMSHVLQFED-KSRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLM 466

Query: 95 RMKRKER 75
R K++ R
Sbjct: 467 REKKERR 473


>sp|Q4IPB3|CWC27_GIBZE Peptidyl-prolyl isomerase CWC27 OS=Gibberella
zeae GN=CWC27 PE=3 SV=1
Length = 548

Score = 32.3 bits (72), Expect = 0.76
Identities = 19/57 (33%), Positives = 28/57 (49%)
Frame = -1

Query: 251 EDDDSGWLTHRLVFNSAKGKRDEMARNDDPEQYVLYDLLVEKGQEKFDKMQARMKRK 81
E DD GW++H L F + K +D R E+ V+ D + K +K AR R+
Sbjct: 461 ESDDEGWMSHALSFAADKLGKDLSNRRKAEEELVVIDPREKARTLKDEKKAARDARQ 517


>sp|Q7ZW86|SDC10_DANRE Peptidyl-prolyl cis-trans isomerase SDCCAG10
OS=Danio rerio GN=sdccag10 PE=2 SV=1
Length = 470

Score = 32.0 bits (71), Expect = 1.00
Identities = 14/38 (36%), Positives = 23/38 (60%)
Frame = -1

Query: 254 AEDDDSGWLTHRLVFNSAKGKRDEMARNDDPEQYVLYD 141
AEDDD GW+ H L F+ + ++ + A D + + +YD
Sbjct: 410 AEDDDKGWMAHVLHFDE-QSRKVKDANMQDEDTFEIYD 446


>sp|A0JP80|FIT2_XENTR Protein FIT2 homolog OS=Xenopus tropicalis
PE=2 SV=1
Length = 260

Score = 30.8 bits (68), Expect = 2.2
Identities = 16/51 (31%), Positives = 25/51 (49%)
Frame = +2

Query: 47 SVIWVLQPTPALFSSSLLASCRTFLDPSQPKDHKERIAQGRHSGPSHPFSL 199
++IW L L+ ++ SC S PK+H++R HSG H F +
Sbjct: 101 TLIWYLCTNLFLYIENITGSCYESEAMSDPKEHQDRRECRLHSGYWHGFDI 151


>sp|Q5R7W3|SDC10_PONAB Peptidyl-prolyl cis-trans isomerase SDCCAG10
OS=Pongo abelii GN=SDCCAG10 PE=2 SV=1
Length = 473

Score = 30.4 bits (67), Expect = 2.9
Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
Frame = -1

Query: 248 DDDSGWLTHRLVFNSAKGKRDEMARNDDPEQYVLYDLL--VEKGQEKFDKMQARMKRKER 75
+DD GW++H L F K ++ + A D + + +YD V K + + K R K++ R
Sbjct: 415 EDDEGWMSHVLQFED-KSRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLMREKKERR 473


>sp|Q4R713|SDC10_MACFA Peptidyl-prolyl cis-trans isomerase SDCCAG10
OS=Macaca fascicularis GN=SDCCAG10 PE=2 SV=1
Length = 473

Score = 30.4 bits (67), Expect = 2.9
Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
Frame = -1

Query: 248 DDDSGWLTHRLVFNSAKGKRDEMARNDDPEQYVLYDLL--VEKGQEKFDKMQARMKRKER 75
+DD GW++H L F K ++ + A D + + +YD V K + + K R K++ R
Sbjct: 415 EDDEGWMSHVLQFED-KSRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLMREKKERR 473


>sp|Q6UX04|SDC10_HUMAN Peptidyl-prolyl cis-trans isomerase SDCCAG10
OS=Homo sapiens GN=SDCCAG10 PE=1 SV=1
Length = 472

Score = 30.4 bits (67), Expect = 2.9
Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
Frame = -1

Query: 248 DDDSGWLTHRLVFNSAKGKRDEMARNDDPEQYVLYDLL--VEKGQEKFDKMQARMKRKER 75
+DD GW++H L F K ++ + A D + + +YD V K + + K R K++ R
Sbjct: 414 EDDEGWMSHVLQFED-KSRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLMREKKERR 472


>sp|Q5F450|PAN2_CHICK PAB-dependent poly(A)-specific ribonuclease
subunit 2 OS=Gallus gallus GN=PAN2 PE=2 SV=1
Length = 1197

Score = 30.4 bits (67), Expect = 2.9
Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 9/42 (21%)
Frame = -1

Query: 233 WLTHRLVFNSAKGKR---------DEMARNDDPEQYVLYDLL 135
W+ H + K K DE++ NDDPE +YDL+
Sbjct: 807 WIPHAIKMRLTKNKELDVCNWSESDELSPNDDPESVYVYDLM 848


tr_hit_id A9T5X8
Definition tr|A9T5X8|A9T5X8_PHYPA Peptidyl-prolyl cis-trans isomerase OS=Physcomitrella patens subsp. patens
Align length 64
Score (bit) 79.7
E-value 7.0e-14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911859|Adiantum capillus-veneris mRNA, clone:
YMU001_000010_A10.
(266 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T5X8|A9T5X8_PHYPA Peptidyl-prolyl cis-trans isomerase OS=Ph... 80 7e-14
tr|B6T621|B6T621_MAIZE Peptidyl-prolyl isomerase CWC27 OS=Zea ma... 77 6e-13
tr|B4FJ63|B4FJ63_MAIZE Putative uncharacterized protein OS=Zea m... 75 2e-12
tr|Q0JLQ1|Q0JLQ1_ORYSJ Peptidyl-prolyl cis-trans isomerase OS=Or... 75 2e-12
tr|A2WRT5|A2WRT5_ORYSI Peptidyl-prolyl cis-trans isomerase OS=Or... 75 2e-12
tr|Q6Q152|Q6Q152_ARATH Peptidyl-prolyl cis-trans isomerase OS=Ar... 72 2e-11
tr|A9PGD9|A9PGD9_POPTR Putative uncharacterized protein OS=Popul... 72 2e-11
tr|A7P4N5|A7P4N5_VITVI Peptidyl-prolyl cis-trans isomerase OS=Vi... 70 5e-11
tr|A8J9P9|A8J9P9_CHLRE Peptidyl-prolyl cis-trans isomerase OS=Ch... 47 5e-04
tr|Q0ICH8|Q0ICH8_SYNS3 Putative uncharacterized protein OS=Synec... 37 0.37
tr|B2B0W7|B2B0W7_PODAN Predicted CDS Pa_3_7560 OS=Podospora anse... 35 1.9
tr|Q2GPD4|Q2GPD4_CHAGB Peptidyl-prolyl cis-trans isomerase OS=Ch... 34 4.1
tr|Q9HZ35|Q9HZ35_PSEAE Putative uncharacterized protein OS=Pseud... 33 5.4
tr|Q02Q12|Q02Q12_PSEAB Putative periplasmic inhibitor/zinc-resis... 33 5.4
tr|A6V2L7|A6V2L7_PSEA7 Putative uncharacterized protein OS=Pseud... 33 5.4
tr|B7V8G6|B7V8G6_PSEAE Putative periplasmic inhibitor/zinc-resis... 33 5.4
tr|A3L6F9|A3L6F9_PSEAE Putative uncharacterized protein OS=Pseud... 33 5.4
tr|A3KWM8|A3KWM8_PSEAE Putative uncharacterized protein OS=Pseud... 33 5.4
tr|B2VVW2|B2VVW2_PYRTR Peptidyl-prolyl isomerase CWC27 OS=Pyreno... 33 5.4
tr|A7E9S6|A7E9S6_SCLS1 Peptidyl-prolyl cis-trans isomerase OS=Sc... 33 5.4
tr|Q88EG1|Q88EG1_PSEPK Putative uncharacterized protein OS=Pseud... 33 7.1
tr|A9PH04|A9PH04_POPTR Putative uncharacterized protein OS=Popul... 33 7.1
tr|A6RQU9|A6RQU9_BOTFB Peptidyl-prolyl cis-trans isomerase OS=Bo... 33 7.1
tr|B0KRX7|B0KRX7_PSEPG Putative uncharacterized protein OS=Pseud... 33 9.2
tr|A5W0A5|A5W0A5_PSEP1 Putative uncharacterized protein OS=Pseud... 33 9.2
tr|B8MTZ2|B8MTZ2_9EURO Ribosomal small subunit assembly protein,... 33 9.2

>tr|A9T5X8|A9T5X8_PHYPA Peptidyl-prolyl cis-trans isomerase
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_140808 PE=3 SV=1
Length = 497

Score = 79.7 bits (195), Expect = 7e-14
Identities = 33/64 (51%), Positives = 48/64 (75%)
Frame = -1

Query: 245 DDSGWLTHRLVFNSAKGKRDEMARNDDPEQYVLYDLLVEKGQEKFDKMQARMKRKEREWA 66
D+ WL+H L F K+D+MA+N+DP QY++YD L+EKG+EKF+K QA+ K++ REWA
Sbjct: 433 DEEDWLSHELKFEKDPTKKDDMAKNEDPNQYMVYDPLLEKGKEKFNKEQAKFKKRNREWA 492

Query: 65 VKPI 54
K +
Sbjct: 493 GKSL 496


>tr|B6T621|B6T621_MAIZE Peptidyl-prolyl isomerase CWC27 OS=Zea mays
PE=2 SV=1
Length = 514

Score = 76.6 bits (187), Expect = 6e-13
Identities = 37/62 (59%), Positives = 47/62 (75%)
Frame = -1

Query: 251 EDDDSGWLTHRLVFNSAKGKRDEMARNDDPEQYVLYDLLVEKGQEKFDKMQARMKRKERE 72
EDD GW T+ L F + K D MAR DDP+ YV+ D L+EKG+EKF+KMQA++KR+ERE
Sbjct: 449 EDDYKGWHTNLLSFLPSSSK-DGMARKDDPDDYVVVDPLLEKGKEKFNKMQAKLKRRERE 507

Query: 71 WA 66
WA
Sbjct: 508 WA 509


>tr|B4FJ63|B4FJ63_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 513

Score = 75.1 bits (183), Expect = 2e-12
Identities = 36/62 (58%), Positives = 46/62 (74%)
Frame = -1

Query: 251 EDDDSGWLTHRLVFNSAKGKRDEMARNDDPEQYVLYDLLVEKGQEKFDKMQARMKRKERE 72
EDD GW T+ L F + K D M R DDP+ YV+ D L+EKG+EKF+KMQA++KR+ERE
Sbjct: 448 EDDYKGWHTNLLSFLPSSSK-DGMTRKDDPDDYVVVDPLLEKGKEKFNKMQAKLKRRERE 506

Query: 71 WA 66
WA
Sbjct: 507 WA 508


>tr|Q0JLQ1|Q0JLQ1_ORYSJ Peptidyl-prolyl cis-trans isomerase OS=Oryza
sativa subsp. japonica GN=Os01g0582400 PE=3 SV=1
Length = 499

Score = 74.7 bits (182), Expect = 2e-12
Identities = 34/62 (54%), Positives = 47/62 (75%)
Frame = -1

Query: 251 EDDDSGWLTHRLVFNSAKGKRDEMARNDDPEQYVLYDLLVEKGQEKFDKMQARMKRKERE 72
E+D +GW ++RL F K D M R DDP+ YV+ D L+EKG++KF+KMQA++KR+ERE
Sbjct: 434 EEDYTGWHSNRLTFEPDSSK-DGMTRKDDPDDYVVVDPLLEKGKQKFNKMQAKLKRRERE 492

Query: 71 WA 66
WA
Sbjct: 493 WA 494


>tr|A2WRT5|A2WRT5_ORYSI Peptidyl-prolyl cis-trans isomerase OS=Oryza
sativa subsp. indica GN=OsI_02575 PE=3 SV=1
Length = 499

Score = 74.7 bits (182), Expect = 2e-12
Identities = 34/62 (54%), Positives = 47/62 (75%)
Frame = -1

Query: 251 EDDDSGWLTHRLVFNSAKGKRDEMARNDDPEQYVLYDLLVEKGQEKFDKMQARMKRKERE 72
E+D +GW ++RL F K D M R DDP+ YV+ D L+EKG++KF+KMQA++KR+ERE
Sbjct: 434 EEDYTGWHSNRLTFEPDSSK-DGMTRKDDPDDYVVVDPLLEKGKQKFNKMQAKLKRRERE 492

Query: 71 WA 66
WA
Sbjct: 493 WA 494


>tr|Q6Q152|Q6Q152_ARATH Peptidyl-prolyl cis-trans isomerase
OS=Arabidopsis thaliana GN=CYP57 PE=2 SV=1
Length = 504

Score = 71.6 bits (174), Expect = 2e-11
Identities = 34/70 (48%), Positives = 50/70 (71%)
Frame = -1

Query: 263 VSAAEDDDSGWLTHRLVFNSAKGKRDEMARNDDPEQYVLYDLLVEKGQEKFDKMQARMKR 84
V E+D S W +L F +GK D+M+R DDP+ Y++ D L+EKG+EKF++MQA+ KR
Sbjct: 435 VDNKEEDLSDWKNVKLKFAPERGK-DKMSRRDDPDAYMVVDPLLEKGKEKFNRMQAKQKR 493

Query: 83 KEREWAVKPI 54
+EREW+ K +
Sbjct: 494 REREWSGKSL 503


>tr|A9PGD9|A9PGD9_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 141

Score = 71.6 bits (174), Expect = 2e-11
Identities = 35/68 (51%), Positives = 48/68 (70%)
Frame = -1

Query: 257 AAEDDDSGWLTHRLVFNSAKGKRDEMARNDDPEQYVLYDLLVEKGQEKFDKMQARMKRKE 78
A +D S W T L F +GK D M+R +DP YV++D L+EKG+EKF++MQA+ KR+E
Sbjct: 74 ADNEDLSDWRTVPLTFAHERGK-DGMSRKEDPNDYVVHDPLLEKGKEKFNRMQAKQKRRE 132

Query: 77 REWAVKPI 54
REWA K +
Sbjct: 133 REWAGKSL 140


>tr|A7P4N5|A7P4N5_VITVI Peptidyl-prolyl cis-trans isomerase OS=Vitis
vinifera GN=GSVIVT00032219001 PE=3 SV=1
Length = 498

Score = 70.1 bits (170), Expect = 5e-11
Identities = 38/71 (53%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
Frame = -1

Query: 263 VSAAEDDDSGWLTH-RLVFNSAKGKRDEMARNDDPEQYVLYDLLVEKGQEKFDKMQARMK 87
V EDDD L +L F GK D M+R+DDP YV++D L+EKG+EKF+KMQA+ K
Sbjct: 428 VEGDEDDDIYSLRGTQLKFTPEPGK-DRMSRSDDPNDYVVHDPLLEKGKEKFNKMQAKQK 486

Query: 86 RKEREWAVKPI 54
R+EREWA K +
Sbjct: 487 RREREWAGKSL 497


>tr|A8J9P9|A8J9P9_CHLRE Peptidyl-prolyl cis-trans isomerase
OS=Chlamydomonas reinhardtii GN=CYN57 PE=3 SV=1
Length = 619

Score = 47.0 bits (110), Expect = 5e-04
Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 1/59 (1%)
Frame = -1

Query: 239 SGWLTHRLVFNSAKGKRDEMARN-DDPEQYVLYDLLVEKGQEKFDKMQARMKRKEREWA 66
+G +HR F +AK ++D MAR+ D+ + YV+YD L+EKG+ K+ + K++ EWA
Sbjct: 558 AGLRSHR--FEAAKERKDNMARDMDNLDDYVVYDPLLEKGKGKWSAANQKEKKRANEWA 614


>tr|Q0ICH8|Q0ICH8_SYNS3 Putative uncharacterized protein
OS=Synechococcus sp. (strain CC9311) GN=sync_0626 PE=4
SV=1
Length = 94

Score = 37.4 bits (85), Expect = 0.37
Identities = 19/55 (34%), Positives = 29/55 (52%)
Frame = -1

Query: 236 GWLTHRLVFNSAKGKRDEMARNDDPEQYVLYDLLVEKGQEKFDKMQARMKRKERE 72
GWLT R + + + RDE + +DP +V Y + GQ F K + + RK+ E
Sbjct: 16 GWLTDRCGYWAMRFHRDEQSDENDPRIFVDYGRGMPNGQSAFLKSRKHLPRKDAE 70