BP911876
Clone id YMU001_000010_C06
Library
Length 527
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000010_C06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CGCGGCCGCAGGAGAGTACTTGAGATGGGCGAGAAAATGGAGGCCAAGAATGATGATGTT
GCTATCCAACATGAGAAGGCTGAAGGTAGGCATGGTTGCACGCTTGCCCACATATTATTG
ACATACAGACGCAAGCACTTTGAGAAGGCCTTCAAGAAGTGGAGTGCTCGGATCAAATCC
ACACATGAACCCGAAGAGCAACCCCATTTTTCTTGTACGGCACGACGCTTGTTGTACAGG
TTCGACATCTTTAATTGACAAATTAAGAATGTAGTAGGATACACTAATCTTGTTCTATGC
AAATGAAAACATTGTGGTCTGTCTTGTAGATGGTGGAGAGATGCTCTTGTCTTTCCCATT
CCCGAGCACCCCAATGATGCATGGTGCAGGTCGGAGAGAGAGGAGACGGGCTTATATCCT
AACGAGTGGATAGATGACTTGCGGCCAAAGGGAGCGTGGCTCAAGTGTCCTTGGTGGCTG
GACTACCCGGACAAGGAGTACCCACCGAGTACCTGCAGGTAATATCT
■■Homology search results ■■ -
sp_hit_id Q9USS7
Definition sp|Q9USS7|YNB3_SCHPO Uncharacterized protein C4.03c OS=Schizosaccharomyces pombe
Align length 107
Score (bit) 34.3
E-value 0.35
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911876|Adiantum capillus-veneris mRNA, clone:
YMU001_000010_C06.
(514 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9USS7|YNB3_SCHPO Uncharacterized protein C4.03c OS=Schizosac... 34 0.35
sp|Q640L5|CCD18_MOUSE Coiled-coil domain-containing protein 18 O... 32 1.8
sp|Q4QLT2|PRMA_HAEI8 Ribosomal protein L11 methyltransferase OS=... 30 6.5
sp|P47114|YJ24_YEAST Uncharacterized vacuolar membrane protein Y... 30 8.7
sp|Q9NNW7|TRXR2_HUMAN Thioredoxin reductase 2, mitochondrial OS=... 30 8.7
sp|Q8VIK5|PEAR1_MOUSE Platelet endothelial aggregation receptor ... 30 8.7

>sp|Q9USS7|YNB3_SCHPO Uncharacterized protein C4.03c
OS=Schizosaccharomyces pombe GN=SPBC4.03c PE=2 SV=1
Length = 891

Score = 34.3 bits (77), Expect = 0.35
Identities = 30/107 (28%), Positives = 52/107 (48%)
Frame = -3

Query: 326 SPPSTRQTTMFSFA*NKISVSYYILNLSIKDVEPVQQASCRTRKMGLLFGFMCGFDPSTP 147
+P R+ + ++ S SY ++L+I VEP+ + + G + D S
Sbjct: 598 TPSGERRVRVVNYCCAVTSKSYDTISLAI--VEPIVAVLAKIASTNIAAGSLK--DTSVR 653

Query: 146 LLEGLLKVLASVCQ*YVGKRATMPTFSLLMLDSNIIILGLHFLAHLK 6
L+EG++K+L+S Y A T L+L N+++L + LA LK
Sbjct: 654 LVEGVVKILSS----YRKVAANRLTPGQLVLPKNLVLLPILILAVLK 696


>sp|Q640L5|CCD18_MOUSE Coiled-coil domain-containing protein 18
OS=Mus musculus GN=Ccdc18 PE=2 SV=1
Length = 1455

Score = 32.0 bits (71), Expect = 1.8
Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 2/103 (1%)
Frame = -1

Query: 421 SIHSLGYKPVSSLSDLHHASLGCSGMGKTRASLHHLQDRPQCFHLHRTRLVYPTTFLICQ 242
S+H+LG + +SS+S ++ CS R L L H RL+YP +C+
Sbjct: 37 SLHNLG-EELSSVSPSENSEYVCSPSRSERLILEELTQPS-----HLGRLIYPPYKKVCK 90

Query: 241 LKMSNLYNKRRAVQEKWGCSS--GSCVDLIRALHFLKAFSKCL 119
S Y K+ Q + S +L LH L+ + CL
Sbjct: 91 TSDSTDYQKKSRDQVSFSSVSMDQEVKNLREKLHKLRQQNACL 133


>sp|Q4QLT2|PRMA_HAEI8 Ribosomal protein L11 methyltransferase
OS=Haemophilus influenzae (strain 86-028NP) GN=prmA PE=3
SV=1
Length = 295

Score = 30.0 bits (66), Expect = 6.5
Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 4/38 (10%)
Frame = +3

Query: 381 EREETGLYPNEWIDDLRP----KGAWLKCPWWLDYPDK 482
E+ E + EW+D+ P K W+ CP W D PDK
Sbjct: 88 EQIEDKDWEREWMDNFHPMQFGKRLWI-CPSWRDVPDK 124


>sp|P47114|YJ24_YEAST Uncharacterized vacuolar membrane protein
YJR054W OS=Saccharomyces cerevisiae GN=YJR054W PE=1 SV=1
Length = 497

Score = 29.6 bits (65), Expect = 8.7
Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
Frame = -1

Query: 145 FLKAFSKCLRLYVNNMWAS--VQPCLPSAFSCWIATSSFLASI 23
F+ C++L N W++ ++P LP S W+ + LASI
Sbjct: 49 FVSDIYTCIKLLAFNSWSNNIIKPYLPFKISKWLFSGCILASI 91


>sp|Q9NNW7|TRXR2_HUMAN Thioredoxin reductase 2, mitochondrial
OS=Homo sapiens GN=TXNRD2 PE=1 SV=3
Length = 524

Score = 29.6 bits (65), Expect = 8.7
Identities = 24/99 (24%), Positives = 37/99 (37%)
Frame = -1

Query: 436 FGRKSSIHSLGYKPVSSLSDLHHASLGCSGMGKTRASLHHLQDRPQCFHLHRTRLVYPTT 257
FG S + P + + L + GC G+ + A H Q+ + +H H P
Sbjct: 383 FGGSSDLMDYDNVPTTVFTPLEY---GCVGLSEEEAVARHGQEHVEVYHAH----YKPLE 435

Query: 256 FLICQLKMSNLYNKRRAVQEKWGCSSGSCVDLIRALHFL 140
F + S Y K ++E L+ LHFL
Sbjct: 436 FTVAGRDASQCYVKMVCLREP--------PQLVLGLHFL 466


>sp|Q8VIK5|PEAR1_MOUSE Platelet endothelial aggregation receptor 1
OS=Mus musculus GN=Pear1 PE=1 SV=1
Length = 1034

Score = 29.6 bits (65), Expect = 8.7
Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 1/63 (1%)
Frame = -2

Query: 225 CTTSVVPYKKNGVALRVHVWI*SEHSTS*RPSQSACVCMSIICGQACNHAYLQPSH-VG* 49
CT + P + G++ + EHS S P C C G CN + Q +H G
Sbjct: 343 CTERLCPDGRYGLSCQEPCTCDPEHSLSCHPMHGECSCQPGWAGLHCNESCPQDTHGPGC 402

Query: 48 QHH 40
Q H
Sbjct: 403 QEH 405


tr_hit_id Q6GMF9
Definition tr|Q6GMF9|Q6GMF9_DANRE Zgc:91964 OS=Danio rerio
Align length 68
Score (bit) 34.7
E-value 2.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911876|Adiantum capillus-veneris mRNA, clone:
YMU001_000010_C06.
(514 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q6GMF9|Q6GMF9_DANRE Zgc:91964 OS=Danio rerio GN=zgc:91964 PE=... 35 2.8
tr|Q4RWZ6|Q4RWZ6_TETNG Chromosome 11 SCAF14979, whole genome sho... 35 2.8
tr|Q1LXG5|Q1LXG5_DANRE Novel protein OS=Danio rerio GN=DKEY-102C... 35 2.8
tr|Q1LXG4|Q1LXG4_DANRE Novel protein (Fragment) OS=Danio rerio G... 35 2.8
tr|A6PUG6|A6PUG6_9BACT Putative uncharacterized protein OS=Victi... 34 4.8

>tr|Q6GMF9|Q6GMF9_DANRE Zgc:91964 OS=Danio rerio GN=zgc:91964 PE=2
SV=1
Length = 515

Score = 34.7 bits (78), Expect = 2.8
Identities = 18/68 (26%), Positives = 31/68 (45%)
Frame = +3

Query: 255 NVVGYTNLVLCK*KHCGLSCRWWRDALVFPIPEHPNDAWCRSEREETGLYPNEWIDDLRP 434
++ TN +LCK H G++C+ E+ +D R++ +E E +D L
Sbjct: 397 DICNETNCLLCKAIHKGMNCK-----------EYQDDLRVRAQNDEAARQTTEMLDQLLK 445

Query: 435 KGAWLKCP 458
G + CP
Sbjct: 446 NGEAMNCP 453


>tr|Q4RWZ6|Q4RWZ6_TETNG Chromosome 11 SCAF14979, whole genome
shotgun sequence. (Fragment) OS=Tetraodon nigroviridis
GN=GSTENG00027629001 PE=4 SV=1
Length = 501

Score = 34.7 bits (78), Expect = 2.8
Identities = 19/65 (29%), Positives = 30/65 (46%)
Frame = +3

Query: 264 GYTNLVLCK*KHCGLSCRWWRDALVFPIPEHPNDAWCRSEREETGLYPNEWIDDLRPKGA 443
G N +LC+ H G++C+ ++D D R+E T L + +D L G
Sbjct: 386 GENNCILCRAIHNGMNCKDYQD-----------DLRIRAENNMTALQTKQMLDRLLQNGE 434

Query: 444 WLKCP 458
+KCP
Sbjct: 435 AMKCP 439


>tr|Q1LXG5|Q1LXG5_DANRE Novel protein OS=Danio rerio
GN=DKEY-102C8.8-001 PE=4 SV=1
Length = 510

Score = 34.7 bits (78), Expect = 2.8
Identities = 18/68 (26%), Positives = 31/68 (45%)
Frame = +3

Query: 255 NVVGYTNLVLCK*KHCGLSCRWWRDALVFPIPEHPNDAWCRSEREETGLYPNEWIDDLRP 434
++ TN +LCK H G++C+ E+ +D R++ +E E +D L
Sbjct: 392 DICNETNCLLCKAIHKGMNCK-----------EYQDDLRVRAQNDEAARQTTEMLDQLLK 440

Query: 435 KGAWLKCP 458
G + CP
Sbjct: 441 NGEAMNCP 448


>tr|Q1LXG4|Q1LXG4_DANRE Novel protein (Fragment) OS=Danio rerio
GN=DKEY-102C8.8-003 PE=4 SV=1
Length = 172

Score = 34.7 bits (78), Expect = 2.8
Identities = 18/68 (26%), Positives = 31/68 (45%)
Frame = +3

Query: 255 NVVGYTNLVLCK*KHCGLSCRWWRDALVFPIPEHPNDAWCRSEREETGLYPNEWIDDLRP 434
++ TN +LCK H G++C+ E+ +D R++ +E E +D L
Sbjct: 58 DICNETNCLLCKAIHKGMNCK-----------EYQDDLRVRAQNDEAARQTTEMLDQLLK 106

Query: 435 KGAWLKCP 458
G + CP
Sbjct: 107 NGEAMNCP 114


>tr|A6PUG6|A6PUG6_9BACT Putative uncharacterized protein
OS=Victivallis vadensis ATCC BAA-548 GN=VvadDRAFT_0417
PE=4 SV=1
Length = 419

Score = 33.9 bits (76), Expect = 4.8
Identities = 16/43 (37%), Positives = 24/43 (55%)
Frame = +3

Query: 330 ALVFPIPEHPNDAWCRSEREETGLYPNEWIDDLRPKGAWLKCP 458
A+ +P+H DAWC+ E+ E P+ +I + AWLK P
Sbjct: 145 AVAVDLPQHEIDAWCQIEKVER--KPDHFIIHVSILNAWLKAP 185