BP911884
Clone id YMU001_000010_D04
Library
Length 541
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000010_D04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTGAAATTAGCAAGGGGTTAGGGTGAAATTAGAGTGTAGGCACACAATTAGCAAGATATG
GTGAAAAACTAGGGAAAAACGAGCACATTGCTTCATGCACACACATTCAAAATCCACAAA
ACCATAAACACACAAGTGAAATTAGTGAGAAAACACATCCGATTATGCCATAACTACAGT
AACGTTGGCCATCGTCCTTGACAATGGTGCCAAATGTTGAGGTTACCATTGTAGCATAGC
TCTAATGACCAACAAAATTATCAATCCGGAGAGTGACCTGGCAGGCTAGGGCATGGAAAC
ACTCACACGATTAGTAAGCTAGTCATGGCAACATGAATGGCGACTCTATGAGGTGAGCTT
CTCGGTCTATGGAGGAGCTAAGCCACAATGATTGGCAATCTCCACGTCCACTTTTCTTCA
TCTCCAATCAACCCAATCACACACACTAACGATTGTAGGACACACACAACACTAATCCTA
TCATGCAACACACTAATCATAAGCACACACACATAGATCTATTAAGCACCACACTCCAGT
T
■■Homology search results ■■ -
sp_hit_id Q6GH45
Definition sp|Q6GH45|MPRF_STAAR Probable lysylphosphatidylglycerol synthetase OS=Staphylococcus aureus (strain MRSA252)
Align length 39
Score (bit) 29.6
E-value 9.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911884|Adiantum capillus-veneris mRNA, clone:
YMU001_000010_D04.
(541 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6GH45|MPRF_STAAR Probable lysylphosphatidylglycerol syntheta... 30 9.9

>sp|Q6GH45|MPRF_STAAR Probable lysylphosphatidylglycerol synthetase
OS=Staphylococcus aureus (strain MRSA252) GN=mprF PE=3
SV=1
Length = 840

Score = 29.6 bits (65), Expect = 9.9
Identities = 15/39 (38%), Positives = 22/39 (56%)
Frame = -1

Query: 181 YCSYGIIGCVFSLISLVCLWFCGF*MCVHEAMCSFFPSF 65
YC+ ++ CV L + V L+FCG + VH + SF F
Sbjct: 198 YCT--LVSCVEWLAAAVVLYFCGVIVDVHVSFMSFIAIF 234


tr_hit_id Q8EFD6
Definition tr|Q8EFD6|Q8EFD6_SHEON Cation efflux family protein OS=Shewanella oneidensis
Align length 71
Score (bit) 35.0
E-value 2.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911884|Adiantum capillus-veneris mRNA, clone:
YMU001_000010_D04.
(541 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8EFD6|Q8EFD6_SHEON Cation efflux family protein OS=Shewanell... 35 2.5
tr|A5C571|A5C571_VITVI Putative uncharacterized protein OS=Vitis... 33 7.4
tr|A5BSV2|A5BSV2_VITVI Putative uncharacterized protein OS=Vitis... 33 7.4

>tr|Q8EFD6|Q8EFD6_SHEON Cation efflux family protein OS=Shewanella
oneidensis GN=SO_2045 PE=4 SV=1
Length = 394

Score = 35.0 bits (79), Expect = 2.5
Identities = 23/71 (32%), Positives = 30/71 (42%)
Frame = +3

Query: 300 HSHD**ASHGNMNGDSMR*ASRSMEELSHNDWQSPRPLFFISNQPNHTH*RL*DTHNTNP 479
HSHD SHGN +G S+ E +H D L + +H H D H+ +
Sbjct: 166 HSHDHGHSHGNSHGHSLHQVHDKHEHTAHKDNHCCDGLEHHAADHDHDHDHDHD-HDHDH 224

Query: 480 IMQHTNHKHTH 512
H NH H H
Sbjct: 225 DHDHDNHSHNH 235


>tr|A5C571|A5C571_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_003258 PE=4 SV=1
Length = 1567

Score = 33.5 bits (75), Expect = 7.4
Identities = 17/42 (40%), Positives = 23/42 (54%)
Frame = +2

Query: 332 HEWRLYEVSFSVYGGAKPQ*LAISTSTFLHLQSTQSHTLTIV 457
+EWR SF+VY G KP +A FL+ + + LTIV
Sbjct: 1449 NEWRTLNASFNVYFGVKPVKVARCGFHFLYAHDYEQNNLTIV 1490


>tr|A5BSV2|A5BSV2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024109 PE=4 SV=1
Length = 1350

Score = 33.5 bits (75), Expect = 7.4
Identities = 17/42 (40%), Positives = 23/42 (54%)
Frame = +2

Query: 332 HEWRLYEVSFSVYGGAKPQ*LAISTSTFLHLQSTQSHTLTIV 457
+EWR SF+VY G KP +A FL+ + + LTIV
Sbjct: 1299 NEWRTLNASFNVYFGVKPVKVARCGFHFLYAHDYEQNNLTIV 1340