BP911899
Clone id YMU001_000010_E12
Library
Length 520
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000010_E12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CGAGTGCAGGGAGGTTGTGAATGGAGTGCCTGATGTTGAAGGAAATGATGCAAAGGATGT
TGTAGATTTGAAATCTGACGAGGATGGAGATCTTAATGATTTGAAACGGAGTAGTGAGCC
CAAGCAACAAGAGCCTGCCAAAAGGATGCGCCGATGGAATTCTGGGGATCGAGTTGCTGG
AGATACCCTCAAGCCGTTGACCTCTGGTACTGTGAAGGAGATCATGCTACCTGAGAGCAG
AGATGGCCTGTCTGCTGTAGGCCAGAGAGGTCTTCAGAAGGTAGTGGCTACCTCAAGGTC
GTTACCTCCCAAAGTGAATGCGGAATCCGAACATGGTAGCAACACTCGATCTGTTCCTCC
ATCAACAAGGGCTCCTTCAAACTCCCTCAAAGTTGAAAGGTTCGTTCGGCCATTCACCTT
GAAAGCAGTCAAAGATTTACTAGCAGAATTCGGAGATTGTACTGGTTTTCGGATGGATCA
AATCAAAACTCACTGTATTGTTTCGTACTCGTCTGTGGAC
■■Homology search results ■■ -
sp_hit_id Q9UKV3
Definition sp|Q9UKV3|ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens
Align length 158
Score (bit) 47.0
E-value 5.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911899|Adiantum capillus-veneris mRNA, clone:
YMU001_000010_E12.
(520 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9UKV3|ACINU_HUMAN Apoptotic chromatin condensation inducer i... 47 5e-05
sp|Q9JIX8|ACINU_MOUSE Apoptotic chromatin condensation inducer i... 47 7e-05
sp|P51892|DNLI1_XENLA DNA ligase 1 OS=Xenopus laevis GN=lig1 PE=... 39 0.015
sp|Q95K37|SPT18_MACFA Spermatogenesis-associated protein 18 OS=M... 34 0.36
sp|P25992|YEMA_DROME Yemanuclein-alpha OS=Drosophila melanogaste... 33 0.62
sp|Q9ESF1|OTOF_MOUSE Otoferlin OS=Mus musculus GN=Otof PE=1 SV=1 33 0.62
sp|O57683|SF3B1_XENLA Splicing factor 3B subunit 1 OS=Xenopus la... 33 1.1
sp|Q09799|KRI1_SCHPO Protein kri1 OS=Schizosaccharomyces pombe G... 33 1.1
sp|Q61290|CAC1E_MOUSE Voltage-dependent R-type calcium channel s... 33 1.1
sp|Q9VYD1|C1716_DROME Probable histone-lysine N-methyltransferas... 33 1.1
sp|Q6INA9|SETB1_XENLA Histone-lysine N-methyltransferase SETDB1 ... 32 1.4
sp|P11746|MCM1_YEAST Pheromone receptor transcription factor OS=... 32 1.4
sp|Q8TC71|SPT18_HUMAN Spermatogenesis-associated protein 18 OS=H... 32 1.8
sp|A5DLL7|RIX1_PICGU Pre-rRNA-processing protein RIX1 OS=Pichia ... 32 1.8
sp|Q9UMS6|SYNP2_HUMAN Synaptopodin-2 OS=Homo sapiens GN=SYNPO2 P... 32 2.4
sp|Q5R539|ARS2_PONAB Arsenite-resistance protein 2 OS=Pongo abel... 32 2.4
sp|Q9BXP5|ARS2_HUMAN Arsenite-resistance protein 2 OS=Homo sapie... 32 2.4
sp|Q9HGN2|YO48_SCHPO Putative nucleosome assembly protein C36B7.... 31 3.1
sp|Q4ACU6|SHAN3_MOUSE SH3 and multiple ankyrin repeat domains pr... 31 3.1
sp|Q88WU9|SYT_LACPL Threonyl-tRNA synthetase OS=Lactobacillus pl... 31 4.0
sp|Q8BMS9|RASF2_MOUSE Ras association domain-containing protein ... 31 4.0
sp|Q66D54|BETA_YERPS Choline dehydrogenase OS=Yersinia pseudotub... 30 5.2
sp|A4TNP2|BETA_YERPP Choline dehydrogenase OS=Yersinia pestis (s... 30 5.2
sp|Q1CFR7|BETA_YERPN Choline dehydrogenase OS=Yersinia pestis bv... 30 5.2
sp|Q8ZGW0|BETA_YERPE Choline dehydrogenase OS=Yersinia pestis GN... 30 5.2
sp|Q1C932|BETA_YERPA Choline dehydrogenase OS=Yersinia pestis bv... 30 5.2
sp|A7FKL6|BETA_YERP3 Choline dehydrogenase OS=Yersinia pseudotub... 30 5.2
sp|Q03954|SPC19_YEAST DASH complex subunit SPC19 OS=Saccharomyce... 30 5.3
sp|Q2VPG3|SDA1_XENLA Protein SDA1 homolog OS=Xenopus laevis GN=s... 30 5.3
sp|Q9NVU7|SDA1_HUMAN Protein SDA1 homolog OS=Homo sapiens GN=SDA... 30 5.3

>sp|Q9UKV3|ACINU_HUMAN Apoptotic chromatin condensation inducer in the
nucleus OS=Homo sapiens GN=ACIN1 PE=1 SV=1
Length = 1341

Score = 47.0 bits (110), Expect = 5e-05
Identities = 42/158 (26%), Positives = 68/158 (43%), Gaps = 4/158 (2%)
Frame = +2

Query: 59 VVDLKSDEDGDLNDLKRSSEPKQQEPAKRMRRWNSGDRVAGDT-LKPLTSGTVKEIMLPE 235
VV + E+G + + EP+ + P +V+ + L P VK++ L +
Sbjct: 924 VVPAEGQENGQREEEEEEKEPEAEPPVP--------PQVSVEVALPPPAEHEVKKVTLGD 975

Query: 236 SRDGLSAVGQRGLQKVVATSRSLPPKVNAESEHGSNTRSVPPSTRAP-SNSLKVERFVRP 412
+ S Q+ V+ + T VP R SN + + VRP
Sbjct: 976 TLTRRSISQQKS-------------GVSITIDDPVRTAQVPSPPRGKISNIVHISNLVRP 1022

Query: 413 FTLKAVKDLLAEFGDCT--GFRMDQIKTHCIVSYSSVD 520
FTL +K+LL G F +D+IK+HC V+YS+V+
Sbjct: 1023 FTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVE 1060


>sp|Q9JIX8|ACINU_MOUSE Apoptotic chromatin condensation inducer in the
nucleus OS=Mus musculus GN=Acin1 PE=1 SV=2
Length = 1338

Score = 46.6 bits (109), Expect = 7e-05
Identities = 26/62 (41%), Positives = 36/62 (58%), Gaps = 3/62 (4%)
Frame = +2

Query: 344 TRSVPPSTRAP-SNSLKVERFVRPFTLKAVKDLLAEFGDCT--GFRMDQIKTHCIVSYSS 514
T VP R SN + + VRPFTL +K+LL G F +D+IK+HC V+YS+
Sbjct: 998 TAQVPSPPRGKISNIVHISNLVRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYST 1057

Query: 515 VD 520
V+
Sbjct: 1058 VE 1059


>sp|P51892|DNLI1_XENLA DNA ligase 1 OS=Xenopus laevis GN=lig1 PE=2
SV=1
Length = 1070

Score = 38.9 bits (89), Expect = 0.015
Identities = 27/102 (26%), Positives = 50/102 (49%)
Frame = +2

Query: 65 DLKSDEDGDLNDLKRSSEPKQQEPAKRMRRWNSGDRVAGDTLKPLTSGTVKEIMLPESRD 244
++K+ E+ ND+++ E ++ +R + +G + GDT P+ + K + ES
Sbjct: 16 EVKTKEEKVKNDVQKEKEEPEKSVPERPLKERNGRALCGDTESPVKRVSKKSARVLES-- 73

Query: 245 GLSAVGQRGLQKVVATSRSLPPKVNAESEHGSNTRSVPPSTR 370
+ + KV AT P K+N ES+ ++ + PPS R
Sbjct: 74 --DSEEEEENSKVQAT----PEKMNNESDPKNDVKETPPSAR 109


>sp|Q95K37|SPT18_MACFA Spermatogenesis-associated protein 18
OS=Macaca fascicularis GN=SPATA18 PE=2 SV=2
Length = 538

Score = 34.3 bits (77), Expect = 0.36
Identities = 44/160 (27%), Positives = 70/160 (43%), Gaps = 10/160 (6%)
Frame = +2

Query: 53 KDVVDLKSDEDGDLNDL-KRSSEPKQQEPA----KRMRRWNSGDRVAGDTLKPLTSGTVK 217
K + L++ ED +RSSE ++ EP +R +W+S R A +TS K
Sbjct: 172 KQLKTLQAQEDARHRHTDQRSSENRRSEPRSSEERRCEQWSSLKRNADQRDTEVTSDYKK 231

Query: 218 EIMLPESRDGLSAVGQRGLQKVVATSRSLPPKVNAESEHGSNTRSVPPST----RAPS-N 382
++ + + + + LQ +SRS P S S +RS PST R+PS N
Sbjct: 232 QLRNLKEEIAVLSAEKSALQG--RSSRSRSPSPAPRSRSCSRSRSASPSTAVKVRSPSPN 289

Query: 383 SLKVERFVRPFTLKAVKDLLAEFGDCTGFRMDQIKTHCIV 502
K+ R KA LL+ F D + ++ C++
Sbjct: 290 RSKLSNVAR----KAA--LLSRFSD--SYSQARLDAQCLL 321


>sp|P25992|YEMA_DROME Yemanuclein-alpha OS=Drosophila melanogaster
GN=yemalpha PE=1 SV=1
Length = 1002

Score = 33.5 bits (75), Expect = 0.62
Identities = 29/121 (23%), Positives = 53/121 (43%), Gaps = 8/121 (6%)
Frame = +2

Query: 89 DLNDLKRSSEPKQQEPAKRMRRWNSGDRVAGDTLKPLTSGTVKEIMLPE------SRDGL 250
+++D + +P Q +P+ +++ A K + + TVK+++ + S+ G
Sbjct: 322 EISDTEDGQDPIQTQPSSQLQSLPQSQAQAQALKKVVKTTTVKDMLKAKRDSFLKSQSGT 381

Query: 251 SAVGQ--RGLQKVVATSRSLPPKVNAESEHGSNTRSVPPSTRAPSNSLKVERFVRPFTLK 424
+AV G K V+T S + ESEHG R + +L+ + P TL
Sbjct: 382 AAVKGVGNGELKCVSTDVSSSDSSDMESEHGRADRQAGQHGKDGQENLRTADTLLPTTLD 441

Query: 425 A 427
A
Sbjct: 442 A 442


>sp|Q9ESF1|OTOF_MOUSE Otoferlin OS=Mus musculus GN=Otof PE=1 SV=1
Length = 1997

Score = 33.5 bits (75), Expect = 0.62
Identities = 38/126 (30%), Positives = 53/126 (42%), Gaps = 9/126 (7%)
Frame = +2

Query: 44 NDAKDVVDLKSDEDGDLNDLKR--SSEPKQQEPAKRMRRWNSGDRVAGDTLKPL-----T 202
+DA VD+ DE K+ S EP+++EP + M W S + DT+K T
Sbjct: 1289 SDAVVKVDVAEDEKERKKKKKKGPSEEPEEEEPDESMLDWWSKYFASIDTMKEQLRQHET 1348

Query: 203 SGTVKEIMLPESRDGLSAVGQRGLQKVVATSRSL--PPKVNAESEHGSNTRSVPPSTRAP 376
SGT L E + SA G +G K SR+ K +S P +A
Sbjct: 1349 SGT----DLEEKEEMESAEGLKGPMKSKEKSRAAKEEKKKKNQSPGPGQGSEAPEKKKAK 1404

Query: 377 SNSLKV 394
+ LKV
Sbjct: 1405 IDELKV 1410


>sp|O57683|SF3B1_XENLA Splicing factor 3B subunit 1 OS=Xenopus
laevis GN=sf3b1 PE=2 SV=1
Length = 1307

Score = 32.7 bits (73), Expect = 1.1
Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
Frame = +2

Query: 80 EDGDLNDLKRSSEPKQ-QEPAKRMRRWN-SGDRVAGDTLKPLTSGTVKEI 223
+ GDL + SS Q P+KR RRW+ +GD+ G T K L+S E+
Sbjct: 175 KSGDLKVVNGSSASSAAQPPSKRKRRWDQTGDQTPGSTPKKLSSWDQAEV 224


>sp|Q09799|KRI1_SCHPO Protein kri1 OS=Schizosaccharomyces pombe
GN=kri1 PE=1 SV=1
Length = 598

Score = 32.7 bits (73), Expect = 1.1
Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 3/74 (4%)
Frame = +2

Query: 8 REVVNGVPDVEGNDAKDVVDLKSDEDGDLNDLKRSSEPKQQEPAKRMRRW---NSGDRVA 178
+E + DV GN KD V +SDEDGD K ++ + +E R+ ++ + A
Sbjct: 205 KETIAAFHDVNGN--KDAVSNESDEDGDFLVKKEKTKKQLEEEEHGYERFLLESAQSKEA 262

Query: 179 GDTLKPLTSGTVKE 220
L+ L+S VK+
Sbjct: 263 RKVLEDLSSSYVKQ 276


>sp|Q61290|CAC1E_MOUSE Voltage-dependent R-type calcium channel
subunit alpha-1E OS=Mus musculus GN=Cacna1e PE=1 SV=1
Length = 2272

Score = 32.7 bits (73), Expect = 1.1
Identities = 16/68 (23%), Positives = 33/68 (48%)
Frame = +2

Query: 2 ECREVVNGVPDVEGNDAKDVVDLKSDEDGDLNDLKRSSEPKQQEPAKRMRRWNSGDRVAG 181
E V +PDV+ VV++ + DG+ + LK + +++E ++ ++ R G
Sbjct: 1068 ESTSVTVAIPDVDPLVDSTVVNISNKTDGEASPLKEAETKEEEEEVEKKKKQKKEKRETG 1127

Query: 182 DTLKPLTS 205
+ P +S
Sbjct: 1128 KAMVPHSS 1135


>sp|Q9VYD1|C1716_DROME Probable histone-lysine N-methyltransferase
CG1716 OS=Drosophila melanogaster GN=Set2 PE=1 SV=2
Length = 2313

Score = 32.7 bits (73), Expect = 1.1
Identities = 29/107 (27%), Positives = 50/107 (46%), Gaps = 4/107 (3%)
Frame = +2

Query: 5 CREVVNGVPDVEGNDAKDVVDLKSDEDGDLNDLKRSSEPKQQEPAKRMRRWNSGDRVAGD 184
CR + G PD +D + +D +SD D ++++ + +EP++ +P K S A
Sbjct: 1497 CRGWIGGEPD---SDEGEQLDEESDSDAEMDEEELEAEPEEGQPRK------SAKAKAKS 1547

Query: 185 TLK---PLTSGTV-KEIMLPESRDGLSAVGQRGLQKVVATSRSLPPK 313
LK PL +G KE P+ R+ + + ++S PPK
Sbjct: 1548 KLKAKLPLATGRKRKEQTKPKDREYKAGRWLKPSATGSSSSAEKPPK 1594


tr_hit_id B8LLW2
Definition tr|B8LLW2|B8LLW2_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 193
Score (bit) 105.0
E-value 1.0e-21
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911899|Adiantum capillus-veneris mRNA, clone:
YMU001_000010_E12.
(520 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LLW2|B8LLW2_PICSI Putative uncharacterized protein OS=Picea... 105 1e-21
tr|O65655|O65655_ARATH Putative uncharacterized protein AT4g3968... 92 1e-17
tr|A9TNC4|A9TNC4_PHYPA Predicted protein OS=Physcomitrella paten... 91 4e-17
tr|A7PL47|A7PL47_VITVI Chromosome chr7 scaffold_20, whole genome... 87 5e-16
tr|A9SKT2|A9SKT2_PHYPA Predicted protein OS=Physcomitrella paten... 86 8e-16
tr|Q7XIG8|Q7XIG8_ORYSJ Os07g0626200 protein OS=Oryza sativa subs... 84 4e-15
tr|B8B4V3|B8B4V3_ORYSI Putative uncharacterized protein OS=Oryza... 84 4e-15
tr|A3BME0|A3BME0_ORYSJ Putative uncharacterized protein OS=Oryza... 84 4e-15
tr|B8AQK0|B8AQK0_ORYSI Putative uncharacterized protein OS=Oryza... 84 5e-15
tr|Q10KI0|Q10KI0_ORYSJ SAP domain containing protein, expressed ... 81 3e-14
tr|A7NV30|A7NV30_VITVI Chromosome chr18 scaffold_1, whole genome... 81 3e-14
tr|Q0DRH6|Q0DRH6_ORYSJ Os03g0383800 protein (Fragment) OS=Oryza ... 77 4e-13
tr|A3AIK4|A3AIK4_ORYSJ Putative uncharacterized protein OS=Oryza... 75 3e-12
tr|Q4S0T2|Q4S0T2_TETNG Chromosome undetermined SCAF14779, whole ... 55 3e-06
tr|Q16N11|Q16N11_AEDAE Putative uncharacterized protein OS=Aedes... 54 5e-06
tr|Q7PVN0|Q7PVN0_ANOGA AGAP009237-PA (Fragment) OS=Anopheles gam... 53 8e-06
tr|Q16HC7|Q16HC7_AEDAE Putative uncharacterized protein OS=Aedes... 53 8e-06
tr|B0WCQ6|B0WCQ6_CULQU Putative uncharacterized protein OS=Culex... 53 1e-05
tr|B3MNR0|B3MNR0_DROAN GF14693 OS=Drosophila ananassae GN=GF1469... 48 3e-04
tr|B4Q9F1|B4Q9F1_DROSI GD24176 OS=Drosophila simulans GN=GD24176... 47 4e-04
tr|A7Z082|A7Z082_BOVIN ACIN1 protein OS=Bos taurus GN=ACIN1 PE=2... 47 6e-04
tr|A4FUB9|A4FUB9_BOVIN ACIN1 protein (Fragment) OS=Bos taurus GN... 47 6e-04
tr|Q69YJ6|Q69YJ6_HUMAN Putative uncharacterized protein DKFZp667... 47 6e-04
tr|B4DQZ7|B4DQZ7_HUMAN cDNA FLJ50838, highly similar to Apoptoti... 47 6e-04
tr|B2RTT4|B2RTT4_HUMAN ACIN1 protein OS=Homo sapiens GN=ACIN1 PE... 47 6e-04
tr|B6ID31|B6ID31_9ZZZZ Apoptotic chromatin condensation inducer ... 47 7e-04
tr|Q80TU6|Q80TU6_MOUSE MKIAA0670 protein (Fragment) OS=Mus muscu... 47 7e-04
tr|Q7TSL7|Q7TSL7_MOUSE Apoptotic chromatin condensation inducer ... 47 7e-04
tr|Q5BJU9|Q5BJU9_RAT Acin1 protein (Fragment) OS=Rattus norvegic... 47 7e-04
tr|Q52KR6|Q52KR6_MOUSE Acin1 protein OS=Mus musculus GN=Acin1 PE... 47 7e-04

>tr|B8LLW2|B8LLW2_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 669

Score = 105 bits (263), Expect = 1e-21
Identities = 72/193 (37%), Positives = 99/193 (51%), Gaps = 20/193 (10%)
Frame = +2

Query: 2 ECREVVNGVPDVEG---NDAKDVV------DLKSDE-DGDLNDL--------KRSSEPKQ 127
E R V + +P V+ +D+ D + D K E +G ND+ K E
Sbjct: 319 ESRTVEDEIPVVKSLREDDSSDAMAIDICQDRKDKEMEGSGNDVETPRDKRKKEGQEAGL 378

Query: 128 QEPAKRMRRWNSGDRVAGDTLKPLTSGTVKEIMLPESRDGLSAV--GQRGLQKVVATSRS 301
EP KR RRWNSG+ ++GD K T K+ LP SA G +
Sbjct: 379 HEPVKRQRRWNSGNNLSGDVAKVST----KDGELPAYSSAASAATSGSTVANRPAPLKPM 434

Query: 302 LPPKVNAESEHGSNTRSVPPSTRAPSNSLKVERFVRPFTLKAVKDLLAEFGDCTGFRMDQ 481
+ + + G R VPPS R P+ SL+++RF+RPFTLKAV++LLA+ G T F MD
Sbjct: 435 MSRPDSTNNGDGQKERVVPPSPRPPTTSLRIDRFLRPFTLKAVQELLAKTGVVTSFWMDH 494

Query: 482 IKTHCIVSYSSVD 520
IKTHC V+YSS++
Sbjct: 495 IKTHCYVTYSSIE 507


>tr|O65655|O65655_ARATH Putative uncharacterized protein AT4g39680
OS=Arabidopsis thaliana GN=AT4g39680 PE=2 SV=1
Length = 633

Score = 92.4 bits (228), Expect = 1e-17
Identities = 57/130 (43%), Positives = 74/130 (56%)
Frame = +2

Query: 131 EPAKRMRRWNSGDRVAGDTLKPLTSGTVKEIMLPESRDGLSAVGQRGLQKVVATSRSLPP 310
EPAKR RRWNS S V E + S + GL++ + S S
Sbjct: 393 EPAKR-RRWNSN------------SIKVPEAQITNSATPTTTPRSTGLKRDFSRSDS--- 436

Query: 311 KVNAESEHGSNTRSVPPSTRAPSNSLKVERFVRPFTLKAVKDLLAEFGDCTGFRMDQIKT 490
+ SE G R VPPS + P+NSL+++RF+RPFTLKAV++LL + G+ T F MD IKT
Sbjct: 437 ---SVSEDGPKERVVPPSPKEPTNSLRIDRFLRPFTLKAVQELLGKTGNVTSFWMDHIKT 493

Query: 491 HCIVSYSSVD 520
HC VSY SV+
Sbjct: 494 HCYVSYPSVE 503


>tr|A9TNC4|A9TNC4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_171035 PE=4 SV=1
Length = 697

Score = 90.5 bits (223), Expect = 4e-17
Identities = 60/168 (35%), Positives = 88/168 (52%), Gaps = 10/168 (5%)
Frame = +2

Query: 47 DAKDVVDLKSDEDGD---LNDLKRSSEPKQQEPAKRMRRWNSG---DRVAGDTLKPLTSG 208
++KD + D D D ++ K++ A + RRWNS + V+G +PL
Sbjct: 389 NSKDGAPMDVDADADAVKVSKRKQTDGENNALDATKRRRWNSAKGDNNVSGKETQPLE-- 446

Query: 209 TVKEIMLPESRD--GLSAVGQRGLQKVVATSRSLPPKVNAESEHGSN--TRSVPPSTRAP 376
V+E P + +A+ + + PP S +G N TR VPPS +
Sbjct: 447 -VQEAAPPSNAPVPSAAALTPKSIPSEKVAITRAPPTRTETSGNGDNRKTRVVPPSAKPA 505

Query: 377 SNSLKVERFVRPFTLKAVKDLLAEFGDCTGFRMDQIKTHCIVSYSSVD 520
+ SLK+++F+RPFT KAVK+LLA+ G MDQIKTHC V+YSSV+
Sbjct: 506 TTSLKIDKFLRPFTFKAVKELLAQTGTVEDVWMDQIKTHCYVTYSSVE 553


>tr|A7PL47|A7PL47_VITVI Chromosome chr7 scaffold_20, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019432001
PE=4 SV=1
Length = 564

Score = 87.0 bits (214), Expect = 5e-16
Identities = 60/172 (34%), Positives = 88/172 (51%), Gaps = 4/172 (2%)
Frame = +2

Query: 17 VNGVPDVEGNDAKDVVDLKSDEDGDLNDLKRSSEPKQQ----EPAKRMRRWNSGDRVAGD 184
VN V DV D K + +++ + KR + K E +KR RRWN+ +
Sbjct: 284 VNVVGDVPSADKKGI-HVETKDRPVAPPEKRKLQGKLSGGNIESSKRQRRWNA------E 336

Query: 185 TLKPLTSGTVKEIMLPESRDGLSAVGQRGLQKVVATSRSLPPKVNAESEHGSNTRSVPPS 364
+LK + P S + + + + R+ + SE R VPPS
Sbjct: 337 SLK---------VPEPLSSNLSPSTTPKDAFQATTLKRNFSRSDSTVSEDAPKERVVPPS 387

Query: 365 TRAPSNSLKVERFVRPFTLKAVKDLLAEFGDCTGFRMDQIKTHCIVSYSSVD 520
+ P+NSL+++RF+RPFTLKAV++LL + G T F MD IKTHC VSY+SV+
Sbjct: 388 PKPPTNSLRIDRFLRPFTLKAVQELLGKTGSVTSFWMDHIKTHCYVSYASVE 439


>tr|A9SKT2|A9SKT2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_233549 PE=4 SV=1
Length = 721

Score = 86.3 bits (212), Expect = 8e-16
Identities = 66/170 (38%), Positives = 90/170 (52%), Gaps = 24/170 (14%)
Frame = +2

Query: 83 DGDLNDLKRSS-------EPKQQEPAKRMRRWNS----GD-RVAGDTLKPLTSGTVKEIM 226
D D + LK S E EP KR RRWNS GD + G ++PL E++
Sbjct: 414 DVDADSLKGSKRKGAVDGENTASEPTKR-RRWNSTKGDGDGKGPGKEIQPL------ELL 466

Query: 227 LPESRDGL----------SAVGQRGLQK-VVATSRSLPPKVNAESEHGSN-TRSVPPSTR 370
SRD + +A+ + + +A +R+ P ++ A S TR VPPS +
Sbjct: 467 ESTSRDAVISPNAPVSSAAALTPKSIPSDKLAVTRTAPVRMEASGNGESQKTRVVPPSAK 526

Query: 371 APSNSLKVERFVRPFTLKAVKDLLAEFGDCTGFRMDQIKTHCIVSYSSVD 520
+ SLK++RF+RPFT KAVK+LLA G MDQIKTHC V+YSSV+
Sbjct: 527 PATTSLKIDRFLRPFTFKAVKELLALTGTVQDIWMDQIKTHCYVTYSSVE 576


>tr|Q7XIG8|Q7XIG8_ORYSJ Os07g0626200 protein OS=Oryza sativa subsp.
japonica GN=OJ1339_F05.120-1 PE=4 SV=1
Length = 792

Score = 84.0 bits (206), Expect = 4e-15
Identities = 51/143 (35%), Positives = 74/143 (51%), Gaps = 4/143 (2%)
Frame = +2

Query: 104 KRSSEPKQ----QEPAKRMRRWNSGDRVAGDTLKPLTSGTVKEIMLPESRDGLSAVGQRG 271
KR +E ++ EP KR R WN D L+ +++ P +R +R
Sbjct: 518 KRKAEDQEVVANNEPIKRQRLWNVDDVKPEQATSKLSGSDASKVVHPPAR-------RRS 570

Query: 272 LQKVVATSRSLPPKVNAESEHGSNTRSVPPSTRAPSNSLKVERFVRPFTLKAVKDLLAEF 451
+ +T+R PK R VPP + + SL+++RFVRPFTLKAV++LL +
Sbjct: 571 FGRSDSTARGNSPK----------ERMVPPPQKPATTSLRIDRFVRPFTLKAVQELLGKT 620

Query: 452 GDCTGFRMDQIKTHCIVSYSSVD 520
G F MD IKTHC V++SSV+
Sbjct: 621 GSVCSFWMDPIKTHCYVTFSSVE 643


>tr|B8B4V3|B8B4V3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_26941 PE=4 SV=1
Length = 906

Score = 84.0 bits (206), Expect = 4e-15
Identities = 51/143 (35%), Positives = 74/143 (51%), Gaps = 4/143 (2%)
Frame = +2

Query: 104 KRSSEPKQ----QEPAKRMRRWNSGDRVAGDTLKPLTSGTVKEIMLPESRDGLSAVGQRG 271
KR +E ++ EP KR R WN D L+ +++ P +R +R
Sbjct: 632 KRKAEDQEVVANNEPIKRQRLWNVDDVKPEQATSKLSGSDASKVVHPPAR-------RRS 684

Query: 272 LQKVVATSRSLPPKVNAESEHGSNTRSVPPSTRAPSNSLKVERFVRPFTLKAVKDLLAEF 451
+ +T+R PK R VPP + + SL+++RFVRPFTLKAV++LL +
Sbjct: 685 FGRSDSTARGNSPK----------ERMVPPPQKPATTSLRIDRFVRPFTLKAVQELLGKT 734

Query: 452 GDCTGFRMDQIKTHCIVSYSSVD 520
G F MD IKTHC V++SSV+
Sbjct: 735 GSVCSFWMDPIKTHCYVTFSSVE 757


>tr|A3BME0|A3BME0_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_024212 PE=4 SV=1
Length = 1348

Score = 84.0 bits (206), Expect = 4e-15
Identities = 51/143 (35%), Positives = 74/143 (51%), Gaps = 4/143 (2%)
Frame = +2

Query: 104 KRSSEPKQ----QEPAKRMRRWNSGDRVAGDTLKPLTSGTVKEIMLPESRDGLSAVGQRG 271
KR +E ++ EP KR R WN D L+ +++ P +R +R
Sbjct: 632 KRKAEDQEVVANNEPIKRQRLWNVDDVKPEQATSKLSGSDASKVVHPPAR-------RRS 684

Query: 272 LQKVVATSRSLPPKVNAESEHGSNTRSVPPSTRAPSNSLKVERFVRPFTLKAVKDLLAEF 451
+ +T+R PK R VPP + + SL+++RFVRPFTLKAV++LL +
Sbjct: 685 FGRSDSTARGNSPK----------ERMVPPPQKPATTSLRIDRFVRPFTLKAVQELLGKT 734

Query: 452 GDCTGFRMDQIKTHCIVSYSSVD 520
G F MD IKTHC V++SSV+
Sbjct: 735 GSVCSFWMDPIKTHCYVTFSSVE 757


>tr|B8AQK0|B8AQK0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_11837 PE=4 SV=1
Length = 797

Score = 83.6 bits (205), Expect = 5e-15
Identities = 59/169 (34%), Positives = 80/169 (47%), Gaps = 4/169 (2%)
Frame = +2

Query: 26 VPDVEGNDAKDVV-DLKSDEDGDLNDLKRSSEPKQQEPAKRMRRWNSGDRVAGDTLKPLT 202
V D D K+V+ D K+ + L+ EP KR RRW + D +P++
Sbjct: 499 VVDDSSVDTKEVIADEKTAASTEKRKLEAEETVAATEPIKRQRRW-AADGAKVPERQPIS 557

Query: 203 ---SGTVKEIMLPESRDGLSAVGQRGLQKVVATSRSLPPKVNAESEHGSNTRSVPPSTRA 373
S KEI P A RS + S R VPPS +
Sbjct: 558 HSGSDAPKEIFQP------------------ALKRSFGRSDSTASGDSPKERVVPPSQKP 599

Query: 374 PSNSLKVERFVRPFTLKAVKDLLAEFGDCTGFRMDQIKTHCIVSYSSVD 520
+ SL+++RFVRPFTLKAV++LL + G F MD IKTHC V++SSV+
Sbjct: 600 ATTSLRIDRFVRPFTLKAVQELLGKTGSLCSFWMDHIKTHCYVTFSSVE 648


>tr|Q10KI0|Q10KI0_ORYSJ SAP domain containing protein, expressed
OS=Oryza sativa subsp. japonica GN=LOC_Os03g26630 PE=4
SV=1
Length = 715

Score = 81.3 bits (199), Expect = 3e-14
Identities = 60/173 (34%), Positives = 84/173 (48%), Gaps = 8/173 (4%)
Frame = +2

Query: 26 VPD-VEGNDAKDVVDLKSDEDGDLNDLKRSSEPKQQ----EPAKRMRRWNSGDRVAGDTL 190
+PD V N + D ++ +DE + KR E ++ EP KR RRW + D
Sbjct: 413 LPDTVVDNSSVDTKEVIADEKTAASTEKRKLEAEETVAATEPIKRQRRW-AADGAKVPER 471

Query: 191 KPLT---SGTVKEIMLPESRDGLSAVGQRGLQKVVATSRSLPPKVNAESEHGSNTRSVPP 361
+P++ S KE P A RS + S R VPP
Sbjct: 472 QPISHSGSDAPKENFQP------------------ALKRSFGRSDSTASGDSPKERVVPP 513

Query: 362 STRAPSNSLKVERFVRPFTLKAVKDLLAEFGDCTGFRMDQIKTHCIVSYSSVD 520
S + + SL+++RFVRPFTLKAV++LL + G F MD IKTHC V++SSV+
Sbjct: 514 SQKPATASLRIDRFVRPFTLKAVQELLGKTGSLCSFWMDHIKTHCYVTFSSVE 566