BP911900
Clone id YMU001_000010_F01
Library
Length 506
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000010_F01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAGCTCTCTATCTGCACTGGTACCTTCAGTGAACCTTCGGCCACCAATTGCATCAATCTC
ATCCATAAAAATAATACAAGGCTGATGATCACGCGCATAACCAAACATCTCACGTATAAG
CCTAGCACTTTCCCCAAGTGTACTTATCCACAATAGCACTTGAGACAACCTTCAAGAAAT
TTGCATCAATGTTGCTGGCAATGGCTCGAGCTAACAAGGTCTTGCCAGTACCAGGTGGTC
CATAAAGCAGGACTCCCTTTGGGGGTTTAATGCCAACTCGCAGGAAAAGCTCTGGATTCA
TGAGAGGCAATTCAATGGACTCTCGAAGCTCTCTAATTTGGTCACTTAGACCCCCTACTG
CAGAATAACTCACGTTGCCAGGGTCTTCATGCAGCATATTGTAAACCACTGGATCCACTT
CACGAGGAAGAGCTCGCATAATCGTCAAAGTAGTCATATCCAAAGCTACTCTTGTGCCCG
ACGTGAGTTTCTCTTTATCCACCTTA
■■Homology search results ■■ -
sp_hit_id P62335
Definition sp|P62335|PRS10_SPETR 26S protease regulatory subunit S10B OS=Spermophilus tridecemlineatus
Align length 122
Score (bit) 203.0
E-value 6.0e-73
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911900|Adiantum capillus-veneris mRNA, clone:
YMU001_000010_F01.
(506 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P62335|PRS10_SPETR 26S protease regulatory subunit S10B OS=Sp... 203 6e-73
sp|P62334|PRS10_MOUSE 26S protease regulatory subunit S10B OS=Mu... 203 6e-73
sp|P62333|PRS10_HUMAN 26S protease regulatory subunit S10B OS=Ho... 203 6e-73
sp|Q2KIW6|PRS10_BOVIN 26S protease regulatory subunit S10B OS=Bo... 203 6e-73
sp|O17071|PRS10_CAEEL Probable 26S protease regulatory subunit S... 198 3e-71
sp|O74445|PRS10_SCHPO Probable 26S protease subunit rpt4 OS=Schi... 193 3e-69
sp|Q54PJ1|PRS10_DICDI 26S protease regulatory subunit S10B OS=Di... 185 9e-68
sp|P53549|PRS10_YEAST 26S protease subunit RPT4 OS=Saccharomyces... 170 2e-61
sp|O26824|PSMR_METTH Proteasome-activating nucleotidase OS=Metha... 142 3e-43
sp|O28303|PSMR_ARCFU Proteasome-activating nucleotidase OS=Archa... 140 3e-43
sp|Q8U4H3|PSMR_PYRFU Proteasome-activating nucleotidase OS=Pyroc... 139 9e-43
sp|O57940|PSMR_PYRHO Proteasome-activating nucleotidase OS=Pyroc... 137 4e-42
sp|Q8TX03|PSMR_METKA Proteasome-activating nucleotidase OS=Metha... 127 3e-41
sp|Q5JHS5|PSMR_PYRKO Proteasome-activating nucleotidase OS=Pyroc... 134 3e-41
sp|Q9V287|PSMR_PYRAB Proteasome-activating nucleotidase OS=Pyroc... 134 3e-41
sp|Q980M1|PSMR_SULSO Proteasome-activating nucleotidase OS=Sulfo... 131 1e-40
sp|P33299|PRS7_YEAST 26S protease regulatory subunit 7 homolog O... 127 2e-40
sp|Q0W257|PSMR_UNCMA Proteasome-activating nucleotidase OS=Uncul... 129 5e-40
sp|Q41365|PRS7_SPIOL 26S protease regulatory subunit 7 OS=Spinac... 125 7e-40
sp|O64982|PRS7_PRUPE 26S protease regulatory subunit 7 OS=Prunus... 125 7e-40
sp|Q9FXT9|PRS7_ORYSJ 26S protease regulatory subunit 7 OS=Oryza ... 125 7e-40
sp|Q9SSB5|PRS7_ARATH 26S protease regulatory subunit 7 OS=Arabid... 125 7e-40
sp|Q6LWR0|PSMR_METMP Proteasome-activating nucleotidase OS=Metha... 131 7e-40
sp|A6VHR1|PSMR_METM7 Proteasome-activating nucleotidase OS=Metha... 131 7e-40
sp|O42931|PRS7_SCHPO 26S protease regulatory subunit 7 homolog O... 124 8e-40
sp|A4G0S4|PSMR_METM5 Proteasome-activating nucleotidase OS=Metha... 130 1e-39
sp|Q18787|PRS7_CAEEL 26S protease regulatory subunit 7 OS=Caenor... 124 2e-39
sp|A3CV35|PSMR_METMJ Proteasome-activating nucleotidase OS=Metha... 126 3e-39
sp|A7I8B8|PSMR_METB6 Proteasome-activating nucleotidase OS=Metha... 127 4e-39
sp|Q975U2|PSMR_SULTO Proteasome-activating nucleotidase OS=Sulfo... 125 4e-39

>sp|P62335|PRS10_SPETR 26S protease regulatory subunit S10B
OS=Spermophilus tridecemlineatus GN=PSMC6 PE=2 SV=1
Length = 389

Score = 203 bits (516), Expect(2) = 6e-73
Identities = 101/122 (82%), Positives = 109/122 (89%)
Frame = -2

Query: 505 KVDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 326
++DK KL GTRVALDMTTLTIMR LPREVDP+VYNM HEDPGNVSYS +GGLS+QIREL
Sbjct: 86 QLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIREL 145

Query: 325 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD 146
RE IELPL NPELF RVGI PPKG LLYGPPGTGKTLLARA+AS +D NFLKVVSS+IVD
Sbjct: 146 REVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVD 205

Query: 145 KY 140
KY
Sbjct: 206 KY 207



Score = 91.3 bits (225), Expect(2) = 6e-73
Identities = 42/46 (91%), Positives = 45/46 (97%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESARLIREMF YARDHQPCIIFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 208 IGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREI 253


>sp|P62334|PRS10_MOUSE 26S protease regulatory subunit S10B OS=Mus
musculus GN=Psmc6 PE=1 SV=1
Length = 389

Score = 203 bits (516), Expect(2) = 6e-73
Identities = 101/122 (82%), Positives = 109/122 (89%)
Frame = -2

Query: 505 KVDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 326
++DK KL GTRVALDMTTLTIMR LPREVDP+VYNM HEDPGNVSYS +GGLS+QIREL
Sbjct: 86 QLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIREL 145

Query: 325 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD 146
RE IELPL NPELF RVGI PPKG LLYGPPGTGKTLLARA+AS +D NFLKVVSS+IVD
Sbjct: 146 REVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVD 205

Query: 145 KY 140
KY
Sbjct: 206 KY 207



Score = 91.3 bits (225), Expect(2) = 6e-73
Identities = 42/46 (91%), Positives = 45/46 (97%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESARLIREMF YARDHQPCIIFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 208 IGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREI 253


>sp|P62333|PRS10_HUMAN 26S protease regulatory subunit S10B OS=Homo
sapiens GN=PSMC6 PE=1 SV=1
Length = 389

Score = 203 bits (516), Expect(2) = 6e-73
Identities = 101/122 (82%), Positives = 109/122 (89%)
Frame = -2

Query: 505 KVDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 326
++DK KL GTRVALDMTTLTIMR LPREVDP+VYNM HEDPGNVSYS +GGLS+QIREL
Sbjct: 86 QLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIREL 145

Query: 325 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD 146
RE IELPL NPELF RVGI PPKG LLYGPPGTGKTLLARA+AS +D NFLKVVSS+IVD
Sbjct: 146 REVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVD 205

Query: 145 KY 140
KY
Sbjct: 206 KY 207



Score = 91.3 bits (225), Expect(2) = 6e-73
Identities = 42/46 (91%), Positives = 45/46 (97%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESARLIREMF YARDHQPCIIFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 208 IGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREI 253


>sp|Q2KIW6|PRS10_BOVIN 26S protease regulatory subunit S10B OS=Bos
taurus GN=PSMC6 PE=2 SV=1
Length = 389

Score = 203 bits (516), Expect(2) = 6e-73
Identities = 101/122 (82%), Positives = 109/122 (89%)
Frame = -2

Query: 505 KVDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 326
++DK KL GTRVALDMTTLTIMR LPREVDP+VYNM HEDPGNVSYS +GGLS+QIREL
Sbjct: 86 QLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIREL 145

Query: 325 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD 146
RE IELPL NPELF RVGI PPKG LLYGPPGTGKTLLARA+AS +D NFLKVVSS+IVD
Sbjct: 146 REVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVD 205

Query: 145 KY 140
KY
Sbjct: 206 KY 207



Score = 91.3 bits (225), Expect(2) = 6e-73
Identities = 42/46 (91%), Positives = 45/46 (97%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESARLIREMF YARDHQPCIIFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 208 IGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREI 253


>sp|O17071|PRS10_CAEEL Probable 26S protease regulatory subunit S10B
OS=Caenorhabditis elegans GN=rpt-4 PE=1 SV=2
Length = 406

Score = 198 bits (504), Expect(2) = 3e-71
Identities = 96/121 (79%), Positives = 109/121 (90%)
Frame = -2

Query: 502 VDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELR 323
++KE+L GTRV+LDMTTLTIMR LPREVDP+VY M HEDPGN+SYS VGGL++QIRELR
Sbjct: 104 INKEELKQGTRVSLDMTTLTIMRQLPREVDPLVYKMSHEDPGNISYSDVGGLAEQIRELR 163

Query: 322 ESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVDK 143
E +ELPL+NPELF RVGI PPKG LL+GPPGTGKTLLARA+AS +D NFLKVVSSAIVDK
Sbjct: 164 EVVELPLINPELFKRVGITPPKGCLLFGPPGTGKTLLARAVASQLDCNFLKVVSSAIVDK 223

Query: 142 Y 140
Y
Sbjct: 224 Y 224



Score = 90.1 bits (222), Expect(2) = 3e-71
Identities = 40/46 (86%), Positives = 45/46 (97%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESAR+IREMF YARDHQPCI+FMDEIDAIGGRRF+EGTSADRE+
Sbjct: 225 IGESARMIREMFNYARDHQPCIVFMDEIDAIGGRRFSEGTSADREI 270


>sp|O74445|PRS10_SCHPO Probable 26S protease subunit rpt4
OS=Schizosaccharomyces pombe GN=rpt4 PE=2 SV=2
Length = 388

Score = 193 bits (491), Expect(2) = 3e-69
Identities = 95/121 (78%), Positives = 108/121 (89%)
Frame = -2

Query: 502 VDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELR 323
VD+ L G RV+LDMTTLTIMR LPREVDP+VYNM EDPG++S++ VGGL++QIRELR
Sbjct: 86 VDQSHLVQGVRVSLDMTTLTIMRILPREVDPLVYNMSIEDPGDISFAGVGGLNEQIRELR 145

Query: 322 ESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVDK 143
E IELPL NPELFLRVGIKPPKGVLLYGPPGTGKTLLARA+A+++ NFLKVVSSAIVDK
Sbjct: 146 EVIELPLKNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAVAASLGVNFLKVVSSAIVDK 205

Query: 142 Y 140
Y
Sbjct: 206 Y 206



Score = 88.6 bits (218), Expect(2) = 3e-69
Identities = 38/46 (82%), Positives = 46/46 (100%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESAR+IREMFGYA++H+PC+IFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 207 IGESARIIREMFGYAKEHEPCVIFMDEIDAIGGRRFSEGTSADREI 252


>sp|Q54PJ1|PRS10_DICDI 26S protease regulatory subunit S10B
OS=Dictyostelium discoideum GN=psmC6 PE=3 SV=1
Length = 393

Score = 185 bits (469), Expect(2) = 9e-68
Identities = 90/116 (77%), Positives = 103/116 (88%)
Frame = -2

Query: 487 LTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELRESIEL 308
L G RV LD+TTLTI++ LPREVDP+++NM E PG+VSY +GGLS+QIRELRE +EL
Sbjct: 96 LVPGARVTLDLTTLTILKILPREVDPIIFNMTAESPGSVSYGEIGGLSNQIRELREVVEL 155

Query: 307 PLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVDKY 140
PLM PELF+RVGIK PKGVLLYGPPGTGKTLLARAIASN++ANFLKVVSSAIVDKY
Sbjct: 156 PLMIPELFIRVGIKAPKGVLLYGPPGTGKTLLARAIASNLEANFLKVVSSAIVDKY 211



Score = 92.0 bits (227), Expect(2) = 9e-68
Identities = 41/46 (89%), Positives = 46/46 (100%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESAR+IREMFGYARDHQPC+IFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 212 IGESARVIREMFGYARDHQPCVIFMDEIDAIGGRRFSEGTSADREI 257


>sp|P53549|PRS10_YEAST 26S protease subunit RPT4 OS=Saccharomyces
cerevisiae GN=RPT4 PE=1 SV=4
Length = 437

Score = 170 bits (430), Expect(2) = 2e-61
Identities = 82/121 (67%), Positives = 98/121 (80%)
Frame = -2

Query: 502 VDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELR 323
VD+ KL G RV LD+TTLTIMR LPRE DP+VYNM + G +++ +GGL++QIRELR
Sbjct: 135 VDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQGEITFDGIGGLTEQIRELR 194

Query: 322 ESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVDK 143
E IELPL NPE+F RVGIKPPKGVLLYGPPGTGKTLLA+A+A+ I ANF+ +S IVDK
Sbjct: 195 EVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDK 254

Query: 142 Y 140
Y
Sbjct: 255 Y 255



Score = 86.3 bits (212), Expect(2) = 2e-61
Identities = 37/46 (80%), Positives = 45/46 (97%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESAR+IREMF YA++H+PCIIFMDE+DAIGGRRF+EGTSADRE+
Sbjct: 256 IGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREI 301


>sp|O26824|PSMR_METTH Proteasome-activating nucleotidase
OS=Methanobacterium thermoautotrophicum GN=pan PE=3 SV=1
Length = 410

Score = 142 bits (359), Expect(2) = 3e-43
Identities = 67/121 (55%), Positives = 92/121 (76%)
Frame = -2

Query: 502 VDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELR 323
+D+++L G RVAL+ T +I+ LP E DPVV M E+ +VSY +GGL +Q+RE++
Sbjct: 105 IDRKQLEPGARVALNQQTFSIVDVLPSEKDPVVTGMEVEEKPDVSYEQIGGLEEQVREVK 164

Query: 322 ESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVDK 143
E++ELPL PELF ++GI+PPKGVLLYGPPGTGKTLLA+A+A +A F+K+V+S V K
Sbjct: 165 ETVELPLKKPELFEKIGIEPPKGVLLYGPPGTGKTLLAKAVAHETNATFIKIVASEFVRK 224

Query: 142 Y 140
Y
Sbjct: 225 Y 225



Score = 52.4 bits (124), Expect(2) = 3e-43
Identities = 23/46 (50%), Positives = 32/46 (69%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GE ARL+R +F A++ P IIF+DEIDA+ +R TS DRE+
Sbjct: 226 IGEGARLVRGVFELAKEKSPSIIFIDEIDAVAAKRLKSSTSGDREV 271


>sp|O28303|PSMR_ARCFU Proteasome-activating nucleotidase
OS=Archaeoglobus fulgidus GN=pan PE=3 SV=1
Length = 398

Score = 140 bits (353), Expect(2) = 3e-43
Identities = 68/121 (56%), Positives = 87/121 (71%)
Frame = -2

Query: 502 VDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELR 323
+++E+L G RVAL+ TL I+ LP DP+VY E+ VSY +GGL QI E+R
Sbjct: 95 INEEELKPGARVALNQQTLAIVNVLPTSKDPMVYGFEVEEKPEVSYEDIGGLDVQIEEIR 154

Query: 322 ESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVDK 143
E++ELPL+ PELF VGI+PPKGVLLYGPPGTGKTLLA+A+A+ A F++VV S V K
Sbjct: 155 EAVELPLLKPELFAEVGIEPPKGVLLYGPPGTGKTLLAKAVANQTRATFIRVVGSEFVQK 214

Query: 142 Y 140
Y
Sbjct: 215 Y 215



Score = 54.7 bits (130), Expect(2) = 3e-43
Identities = 25/46 (54%), Positives = 33/46 (71%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GE ARL+RE+F A++ P IIF+DE+DAI RR TS DRE+
Sbjct: 216 IGEGARLVREVFQLAKEKAPSIIFIDELDAIAARRTNSDTSGDREV 261


tr_hit_id A5AEB9
Definition tr|A5AEB9|A5AEB9_VITVI Putative uncharacterized protein (Chromosome chr18 scaffold_1, whole genome shotgun sequence) OS=Vitis vinifera
Align length 122
Score (bit) 238.0
E-value 5.0e-83
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911900|Adiantum capillus-veneris mRNA, clone:
YMU001_000010_F01.
(506 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5AEB9|A5AEB9_VITVI Putative uncharacterized protein (Chromos... 238 5e-83
tr|A9PB39|A9PB39_POPTR Putative uncharacterized protein OS=Popul... 237 9e-83
tr|A9PEV6|A9PEV6_POPTR Putative uncharacterized protein OS=Popul... 236 1e-82
tr|Q9FXT8|Q9FXT8_ORYSJ Os02g0199900 protein OS=Oryza sativa subs... 236 2e-82
tr|B8ADT3|B8ADT3_ORYSI Putative uncharacterized protein OS=Oryza... 236 2e-82
tr|B4FTV9|B4FTV9_MAIZE 26S protease regulatory subunit S10B OS=Z... 236 2e-82
tr|Q8H9D4|Q8H9D4_SOLTU 26S proteasome AAA-ATPase subunit RPT4a O... 237 3e-82
tr|A7P8W2|A7P8W2_VITVI Chromosome chr3 scaffold_8, whole genome ... 234 4e-82
tr|A9NWQ8|A9NWQ8_PICSI Putative uncharacterized protein OS=Picea... 234 4e-82
tr|A9S4A7|A9S4A7_PHYPA 26S proteasome regulatory complex, ATPase... 236 7e-82
tr|A9RK27|A9RK27_PHYPA 26S proteasome regulatory complex, ATPase... 236 7e-82
tr|A9SLQ6|A9SLQ6_PHYPA 26S proteasome regulatory complex, ATPase... 236 1e-81
tr|B8LLX8|B8LLX8_PICSI Putative uncharacterized protein OS=Picea... 233 1e-81
tr|Q9SEI3|Q9SEI3_ARATH 26S proteasome AAA-ATPase subunit RPT4a (... 236 3e-81
tr|Q9MAK9|Q9MAK9_ARATH F27F5.8 (26S proteasome AAA-ATPase subuni... 236 3e-81
tr|B3H533|B3H533_ARATH Uncharacterized protein At1g45000.2 OS=Ar... 236 3e-81
tr|Q9M606|Q9M606_VITRI 26S proteasome regulatory ATPase subunit ... 233 5e-81
tr|Q69Q32|Q69Q32_ORYSJ Os06g0607800 protein OS=Oryza sativa subs... 231 9e-80
tr|Q8W3N8|Q8W3N8_ORYSJ 26S proteasome regulatory particle triple... 231 9e-80
tr|B8B4N6|B8B4N6_ORYSI Putative uncharacterized protein OS=Oryza... 225 5e-78
tr|A8IR41|A8IR41_CHLRE 26S proteasome regulatory subunit OS=Chla... 221 3e-77
tr|Q8SZ19|Q8SZ19_DROME RE23388p OS=Drosophila melanogaster GN=Rp... 211 3e-74
tr|Q9W414|Q9W414_DROME Rpt4 OS=Drosophila melanogaster GN=Rpt4 P... 211 3e-74
tr|Q7PXH7|Q7PXH7_ANOGA AGAP001407-PA (Fragment) OS=Anopheles gam... 210 5e-74
tr|Q1HQM1|Q1HQM1_AEDAE 26S proteasome regulatory complex ATPase ... 210 5e-74
tr|B0W8M6|B0W8M6_CULQU 26S protease regulatory subunit S10B OS=C... 210 5e-74
tr|B3RLH5|B3RLH5_TRIAD Putative uncharacterized protein OS=Trich... 209 7e-74
tr|Q29HL5|Q29HL5_DROPS GA17461 OS=Drosophila pseudoobscura pseud... 209 9e-74
tr|B4PYR1|B4PYR1_DROYA GE16469 OS=Drosophila yakuba GN=GE16469 P... 209 9e-74
tr|B4NER3|B4NER3_DROWI GK25687 OS=Drosophila willistoni GN=GK256... 209 9e-74

>tr|A5AEB9|A5AEB9_VITVI Putative uncharacterized protein (Chromosome
chr18 scaffold_1, whole genome shotgun sequence)
OS=Vitis vinifera GN=GSVIVT00014552001 PE=3 SV=1
Length = 398

Score = 238 bits (606), Expect(2) = 5e-83
Identities = 120/122 (98%), Positives = 121/122 (99%)
Frame = -2

Query: 505 KVDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 326
KVDKEKLTSGTRV LDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL
Sbjct: 91 KVDKEKLTSGTRVVLDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 150

Query: 325 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD 146
RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAI+D
Sbjct: 151 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIID 210

Query: 145 KY 140
KY
Sbjct: 211 KY 212



Score = 93.6 bits (231), Expect(2) = 5e-83
Identities = 43/46 (93%), Positives = 46/46 (100%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESARLIREMFGYARDHQPCIIFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 213 IGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREI 258


>tr|A9PB39|A9PB39_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 402

Score = 237 bits (604), Expect(2) = 9e-83
Identities = 119/122 (97%), Positives = 121/122 (99%)
Frame = -2

Query: 505 KVDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 326
KVDKEKLTSGTRV LDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL
Sbjct: 95 KVDKEKLTSGTRVVLDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 154

Query: 325 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD 146
RESIELPLMNPELF+RVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAI+D
Sbjct: 155 RESIELPLMNPELFIRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIID 214

Query: 145 KY 140
KY
Sbjct: 215 KY 216



Score = 93.6 bits (231), Expect(2) = 9e-83
Identities = 43/46 (93%), Positives = 46/46 (100%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESARLIREMFGYARDHQPCIIFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 217 IGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREI 262


>tr|A9PEV6|A9PEV6_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 399

Score = 236 bits (603), Expect(2) = 1e-82
Identities = 119/122 (97%), Positives = 121/122 (99%)
Frame = -2

Query: 505 KVDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 326
KVDKEKLT+GTRV LDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL
Sbjct: 92 KVDKEKLTAGTRVVLDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 151

Query: 325 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD 146
RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAI+D
Sbjct: 152 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIID 211

Query: 145 KY 140
KY
Sbjct: 212 KY 213



Score = 93.6 bits (231), Expect(2) = 1e-82
Identities = 43/46 (93%), Positives = 46/46 (100%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESARLIREMFGYARDHQPCIIFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 214 IGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREI 259


>tr|Q9FXT8|Q9FXT8_ORYSJ Os02g0199900 protein OS=Oryza sativa subsp.
japonica GN=OsRPT4 PE=2 SV=1
Length = 400

Score = 236 bits (601), Expect(2) = 2e-82
Identities = 118/122 (96%), Positives = 120/122 (98%)
Frame = -2

Query: 505 KVDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 326
KVDKEKLTSGTRV LDMTTLTIMR LPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL
Sbjct: 93 KVDKEKLTSGTRVVLDMTTLTIMRTLPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 152

Query: 325 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD 146
RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLK+VSSAI+D
Sbjct: 153 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKIVSSAIID 212

Query: 145 KY 140
KY
Sbjct: 213 KY 214



Score = 93.6 bits (231), Expect(2) = 2e-82
Identities = 43/46 (93%), Positives = 46/46 (100%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESARLIREMFGYARDHQPCIIFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 215 IGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREI 260


>tr|B8ADT3|B8ADT3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_06267 PE=4 SV=1
Length = 400

Score = 236 bits (601), Expect(2) = 2e-82
Identities = 118/122 (96%), Positives = 120/122 (98%)
Frame = -2

Query: 505 KVDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 326
KVDKEKLTSGTRV LDMTTLTIMR LPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL
Sbjct: 93 KVDKEKLTSGTRVVLDMTTLTIMRTLPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 152

Query: 325 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD 146
RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLK+VSSAI+D
Sbjct: 153 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKIVSSAIID 212

Query: 145 KY 140
KY
Sbjct: 213 KY 214



Score = 93.6 bits (231), Expect(2) = 2e-82
Identities = 43/46 (93%), Positives = 46/46 (100%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESARLIREMFGYARDHQPCIIFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 215 IGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREI 260


>tr|B4FTV9|B4FTV9_MAIZE 26S protease regulatory subunit S10B OS=Zea
mays PE=2 SV=1
Length = 400

Score = 236 bits (601), Expect(2) = 2e-82
Identities = 118/122 (96%), Positives = 120/122 (98%)
Frame = -2

Query: 505 KVDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 326
KVDKEKLTSGTRV LDMTTLTIMR LPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL
Sbjct: 93 KVDKEKLTSGTRVVLDMTTLTIMRTLPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 152

Query: 325 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD 146
RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLK+VSSAI+D
Sbjct: 153 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKIVSSAIID 212

Query: 145 KY 140
KY
Sbjct: 213 KY 214



Score = 93.6 bits (231), Expect(2) = 2e-82
Identities = 43/46 (93%), Positives = 46/46 (100%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESARLIREMFGYARDHQPCIIFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 215 IGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREI 260


>tr|Q8H9D4|Q8H9D4_SOLTU 26S proteasome AAA-ATPase subunit RPT4a
OS=Solanum tuberosum GN=StRPT4a PE=2 SV=1
Length = 398

Score = 237 bits (605), Expect(2) = 3e-82
Identities = 119/122 (97%), Positives = 121/122 (99%)
Frame = -2

Query: 505 KVDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 326
KVDKEKLTSGTRV LDMTTLTIMRALPREVDPVVYNMLHEDPGN+SYSAVGGLSDQIREL
Sbjct: 91 KVDKEKLTSGTRVVLDMTTLTIMRALPREVDPVVYNMLHEDPGNISYSAVGGLSDQIREL 150

Query: 325 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD 146
RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAI+D
Sbjct: 151 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIID 210

Query: 145 KY 140
KY
Sbjct: 211 KY 212



Score = 91.3 bits (225), Expect(2) = 3e-82
Identities = 42/46 (91%), Positives = 45/46 (97%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESARLIREMF YARDHQPCIIFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 213 IGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREI 258


>tr|A7P8W2|A7P8W2_VITVI Chromosome chr3 scaffold_8, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00036330001
PE=3 SV=1
Length = 399

Score = 234 bits (598), Expect(2) = 4e-82
Identities = 117/122 (95%), Positives = 121/122 (99%)
Frame = -2

Query: 505 KVDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 326
KVDKEKLT+GTRV LDMTTLTIMRALPREVDPVVYNMLHEDPGNVSY+AVGGLSDQIREL
Sbjct: 92 KVDKEKLTAGTRVVLDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYAAVGGLSDQIREL 151

Query: 325 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD 146
RESIELPLMNPELF+RVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAI+D
Sbjct: 152 RESIELPLMNPELFIRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIID 211

Query: 145 KY 140
KY
Sbjct: 212 KY 213



Score = 93.6 bits (231), Expect(2) = 4e-82
Identities = 43/46 (93%), Positives = 46/46 (100%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESARLIREMFGYARDHQPCIIFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 214 IGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREI 259


>tr|A9NWQ8|A9NWQ8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 398

Score = 234 bits (598), Expect(2) = 4e-82
Identities = 117/122 (95%), Positives = 121/122 (99%)
Frame = -2

Query: 505 KVDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 326
KVDKEKLT+GTRV LDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGL+DQIREL
Sbjct: 91 KVDKEKLTAGTRVVLDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLADQIREL 150

Query: 325 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD 146
RESIELPLMNPELF+RVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAI+D
Sbjct: 151 RESIELPLMNPELFIRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIID 210

Query: 145 KY 140
KY
Sbjct: 211 KY 212



Score = 93.6 bits (231), Expect(2) = 4e-82
Identities = 43/46 (93%), Positives = 46/46 (100%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESARLIREMFGYARDHQPCIIFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 213 IGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREI 258


>tr|A9S4A7|A9S4A7_PHYPA 26S proteasome regulatory complex, ATPase
RPT4 OS=Physcomitrella patens subsp. patens GN=PATPA1501
PE=3 SV=1
Length = 392

Score = 236 bits (602), Expect(2) = 7e-82
Identities = 119/122 (97%), Positives = 121/122 (99%)
Frame = -2

Query: 505 KVDKEKLTSGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIREL 326
KVDKEKL +GTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGN+SYSAVGGLSDQIREL
Sbjct: 85 KVDKEKLVAGTRVALDMTTLTIMRALPREVDPVVYNMLHEDPGNISYSAVGGLSDQIREL 144

Query: 325 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD 146
RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD
Sbjct: 145 RESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIVD 204

Query: 145 KY 140
KY
Sbjct: 205 KY 206



Score = 91.3 bits (225), Expect(2) = 7e-82
Identities = 42/46 (91%), Positives = 45/46 (97%)
Frame = -3

Query: 138 LGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFTEGTSADREL 1
+GESARLIREMF YARDHQPCIIFMDEIDAIGGRRF+EGTSADRE+
Sbjct: 207 IGESARLIREMFSYARDHQPCIIFMDEIDAIGGRRFSEGTSADREI 252