BP911917
Clone id YMU001_000010_C08
Library
Length 518
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000010_C08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTGACCAAACTCACAAAAGTGAGTGGAAGAATAAAATTAAAAGCAGCATAGACCATACAA
ACTCCGTGCAGGACTTGCAAAACGAACTACCAGATATGCCAGGCTAAGCAGGGAAGACAC
CCCACCATTCACAACATCACCACAAAGATAACCTAGGTAGATCGGGTAATCTGGGGGCCA
CCCATTGATAATCGAGAACATGCATCCGAAGAAAAGGGGGAGCTTGGGAGCTCCATCACC
TGCAAGATATGAGCGACCATGGATGAATTTGAGCTGGCACCACGAATCGATCCTCCGAAG
GAAGGATCCTGTAGACCACACCACCATAGTCGGGGGTCCGCCACACCAACGGACTATGTC
CACATAAGCTATCACATGGTGCTCTCACACGGTGAGCATGCCCAAACACCAAACTTCGCG
TCTCGACCACCATGTAGGCCTTCCAGCTTGGAGCCCTTCTGCAGAATATAGCATGCCGTC
CTGCCTCACAGTCGGAAGCAAAGCCCATGGCGAAGGAG
■■Homology search results ■■ -
sp_hit_id Q56A06
Definition sp|Q56A06|TMTC2_MOUSE Transmembrane and TPR repeat-containing protein 2 OS=Mus musculus
Align length 37
Score (bit) 31.6
E-value 2.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911917|Adiantum capillus-veneris mRNA, clone:
YMU001_000010_C08.
(518 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q56A06|TMTC2_MOUSE Transmembrane and TPR repeat-containing pr... 32 2.3
sp|Q9S7Y1|BH030_ARATH Transcription factor bHLH30 OS=Arabidopsis... 32 2.3
sp|O67542|Y1612_AQUAE Uncharacterized protein aq_1612 OS=Aquifex... 31 3.0
sp|Q9Z0K9|AMEL_CAVPO Amelogenin OS=Cavia porcellus GN=AMEL PE=2 ... 31 4.0
sp|Q9FT45|FLA15_ARATH Fasciclin-like arabinogalactan protein 15 ... 30 5.2
sp|Q1LUS8|RBP10_DANRE Ran-binding protein 10 OS=Danio rerio GN=r... 30 6.8
sp|Q7NIH2|CRCB_GLOVI Protein crcB homolog OS=Gloeobacter violace... 30 6.8
sp|Q9QYK4|H6ST3_MOUSE Heparan-sulfate 6-O-sulfotransferase 3 OS=... 30 8.8
sp|Q98UK5|MAFB_DANRE Transcription factor MafB OS=Danio rerio GN... 27 9.0

>sp|Q56A06|TMTC2_MOUSE Transmembrane and TPR repeat-containing
protein 2 OS=Mus musculus GN=Tmtc2 PE=2 SV=1
Length = 836

Score = 31.6 bits (70), Expect = 2.3
Identities = 14/37 (37%), Positives = 22/37 (59%)
Frame = -1

Query: 332 RLWWCGLQDPSFGGSIRGASSNSSMVAHILQVMELPS 222
RL+W G + PSF S A+ + S++A L + LP+
Sbjct: 242 RLYWMGNKPPSFSNSDNPAADSDSLLARTLTFLYLPT 278


>sp|Q9S7Y1|BH030_ARATH Transcription factor bHLH30 OS=Arabidopsis
thaliana GN=BHLH30 PE=1 SV=1
Length = 368

Score = 31.6 bits (70), Expect = 2.3
Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 4/59 (6%)
Frame = +3

Query: 15 KSEWKNKIKSSIDHTNSVQDLQNELPDMPG*AGKTPHHSQHHH----KDNLGRSGNLGA 179
K E + + + S + N++Q+ QN+L HH HHH + LG SGN+G+
Sbjct: 5 KEEEEEEEEDSSEAMNNIQNYQNDLFFHQ----LISHHHHHHHDPSQSETLGASGNVGS 59


>sp|O67542|Y1612_AQUAE Uncharacterized protein aq_1612 OS=Aquifex
aeolicus GN=aq_1612 PE=3 SV=1
Length = 486

Score = 31.2 bits (69), Expect = 3.0
Identities = 15/42 (35%), Positives = 23/42 (54%)
Frame = +2

Query: 278 HHESILRRKDPVDHTTIVGGPPHQRTMST*AITWCSHTVSMP 403
H +I+ RKDP+ TTIVG PP + + W + + +P
Sbjct: 301 HVTAIVMRKDPIYLTTIVGRPPQEDKY----LGWATERIFLP 338


>sp|Q9Z0K9|AMEL_CAVPO Amelogenin OS=Cavia porcellus GN=AMEL PE=2
SV=1
Length = 226

Score = 30.8 bits (68), Expect = 4.0
Identities = 18/56 (32%), Positives = 24/56 (42%)
Frame = +1

Query: 292 PPKEGSCRPHHHSRGSATPTDYVHISYHMVLSHGEHAQTPNFASRPPCRPSSLEPF 459
PP + PHHH V M + G H+ TPN +P P+S +PF
Sbjct: 89 PPSHTTLPPHHHIPVGPAQQPVVPQQPLMPVP-GHHSMTPNQHHQPNLPPTSQQPF 143


>sp|Q9FT45|FLA15_ARATH Fasciclin-like arabinogalactan protein 15
OS=Arabidopsis thaliana GN=FLA15 PE=2 SV=1
Length = 436

Score = 30.4 bits (67), Expect = 5.2
Identities = 18/67 (26%), Positives = 26/67 (38%), Gaps = 1/67 (1%)
Frame = +1

Query: 178 PPIDNREHASEEKGELGSSITCKI*ATMDEFELAPRIDP-PKEGSCRPHHHSRGSATPTD 354
P +D R H ++K + + D P + P P G P HH G A D
Sbjct: 192 PEVDPRTHRLKKKPAPIPAGAPPVLPVYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKD 251

Query: 355 YVHISYH 375
++H H
Sbjct: 252 FIHTLLH 258


>sp|Q1LUS8|RBP10_DANRE Ran-binding protein 10 OS=Danio rerio
GN=ranbp10 PE=3 SV=1
Length = 604

Score = 30.0 bits (66), Expect = 6.8
Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
Frame = +1

Query: 256 TMDEFELAPRIDPPKEGSCRPHHHSRGSATPTDYVHIS-YHMVLSHGEHAQTPNFASRPP 432
+ D + +P + P + G+ PH HS G+ +PT ++ + SH ++ + +S P
Sbjct: 346 SQDSYPGSPNMSP-RHGATNPHLHSTGADSPTCSNGVTPPNKNKSHNKYTGISSASSSPS 404

Query: 433 CRPSSL 450
PSS+
Sbjct: 405 SSPSSV 410


>sp|Q7NIH2|CRCB_GLOVI Protein crcB homolog OS=Gloeobacter violaceus
GN=crcB PE=3 SV=1
Length = 125

Score = 30.0 bits (66), Expect = 6.8
Identities = 28/89 (31%), Positives = 39/89 (43%), Gaps = 11/89 (12%)
Frame = -3

Query: 357 IVRWCGGPP----TMVVWSTGSF-LRRIDSWC-QLKFIHGRSYLAGDG-----APKLPLF 211
I +W G PP T++V GSF L + +W L+ LAG G L
Sbjct: 26 ISQWAGAPPFLFGTLLVNLVGSFMLGGLFAWSVALRIDPALLLLAGTGFCGGFTTFSALS 85

Query: 210 FGCMFSIINGWPPDYPIYLGYLCGDVVNG 124
C+ + G DYP +GYL G ++ G
Sbjct: 86 IECLVLLQKG---DYPTAMGYLLGSLLGG 111


>sp|Q9QYK4|H6ST3_MOUSE Heparan-sulfate 6-O-sulfotransferase 3 OS=Mus
musculus GN=Hs6st3 PE=1 SV=1
Length = 470

Score = 29.6 bits (65), Expect = 8.8
Identities = 15/34 (44%), Positives = 19/34 (55%)
Frame = +1

Query: 253 ATMDEFELAPRIDPPKEGSCRPHHHSRGSATPTD 354
A +DE+E P++ PP G P SRG A P D
Sbjct: 60 APLDEWERRPQLPPPPRG---PPEGSRGVAAPED 90


>sp|Q98UK5|MAFB_DANRE Transcription factor MafB OS=Danio rerio
GN=mafb PE=2 SV=1
Length = 356

Score = 27.3 bits (59), Expect(2) = 9.0
Identities = 10/21 (47%), Positives = 12/21 (57%)
Frame = +3

Query: 81 NELPDMPG*AGKTPHHSQHHH 143
++L PG G PHH HHH
Sbjct: 175 DDLSGHPGAHGHHPHHHHHHH 195



Score = 20.8 bits (42), Expect(2) = 9.0
Identities = 7/18 (38%), Positives = 10/18 (55%)
Frame = +3

Query: 123 HHSQHHHKDNLGRSGNLG 176
HH HH + G+ G+ G
Sbjct: 215 HHHHHHPHGHPGQQGHHG 232


tr_hit_id A7PD40
Definition tr|A7PD40|A7PD40_VITVI Chromosome chr17 scaffold_12, whole genome shotgun sequence OS=Vitis vinifera
Align length 42
Score (bit) 37.0
E-value 0.59
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911917|Adiantum capillus-veneris mRNA, clone:
YMU001_000010_C08.
(518 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PD40|A7PD40_VITVI Chromosome chr17 scaffold_12, whole genom... 37 0.59
tr|B2SH77|B2SH77_FRATM Endonuclease III OS=Francisella tularensi... 36 1.3
tr|A3HV71|A3HV71_9SPHI Putative endonuclease OS=Algoriphagus sp.... 35 1.7
tr|B2W378|B2W378_PYRTR Putative uncharacterized protein OS=Pyren... 35 1.7
tr|A0Q6Q7|A0Q6Q7_FRATN Endonuclease III OS=Francisella tularensi... 34 5.0
tr|B4AUC3|B4AUC3_FRANO Endonuclease III OS=Francisella novicida ... 34 5.0
tr|A7JM74|A7JM74_FRANO Endonuclease III OS=Francisella novicida ... 34 5.0
tr|A7JI30|A7JI30_FRANO Putative uncharacterized protein OS=Franc... 34 5.0
tr|Q5NH26|Q5NH26_FRATT Endonuclease III OS=Francisella tularensi... 33 6.5
tr|Q5L3K0|Q5L3K0_GEOKA Putative uncharacterized protein GK0195 O... 33 6.5
tr|Q2A3R8|Q2A3R8_FRATH Endonuclease III OS=Francisella tularensi... 33 6.5
tr|Q14IH8|Q14IH8_FRAT1 Endonuclease III OS=Francisella tularensi... 33 6.5
tr|Q0BM72|Q0BM72_FRATO DNA-(Apurinic or apyrimidinic site) lyase... 33 6.5
tr|A7NBU4|A7NBU4_FRATF Endonuclease III OS=Francisella tularensi... 33 6.5
tr|A4IY94|A4IY94_FRATW Endonuclease III OS=Francisella tularensi... 33 6.5
tr|A7YTF9|A7YTF9_FRATU Putative uncharacterized protein OS=Franc... 33 6.5
tr|A7JBS6|A7JBS6_FRATT Putative uncharacterized protein OS=Franc... 33 6.5
tr|A6TTQ4|A6TTQ4_ALKMQ Oxidoreductase domain protein OS=Alkaliph... 33 8.5
tr|A8HUY1|A8HUY1_CHLRE Predicted protein (Fragment) OS=Chlamydom... 33 8.5
tr|Q0IFF7|Q0IFF7_AEDAE Putative uncharacterized protein OS=Aedes... 33 8.5

>tr|A7PD40|A7PD40_VITVI Chromosome chr17 scaffold_12, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016129001
PE=4 SV=1
Length = 1127

Score = 37.0 bits (84), Expect = 0.59
Identities = 17/42 (40%), Positives = 25/42 (59%)
Frame = +1

Query: 304 GSCRPHHHSRGSATPTDYVHISYHMVLSHGEHAQTPNFASRP 429
GSC+PH H + ++ + H++YH S +QTPNF S P
Sbjct: 1063 GSCKPHQHQKMASA---WYHVTYHSTFS----SQTPNFLSFP 1097


>tr|B2SH77|B2SH77_FRATM Endonuclease III OS=Francisella tularensis
subsp. mediasiatica (strain FSC147) GN=nth PE=4 SV=1
Length = 212

Score = 35.8 bits (81), Expect = 1.3
Identities = 20/65 (30%), Positives = 29/65 (44%)
Frame = +1

Query: 268 FELAPRIDPPKEGSCRPHHHSRGSATPTDYVHISYHMVLSHGEHAQTPNFASRPPCRPSS 447
F LA RI K + P +Y+H ++H ++ HG H T A RP CR
Sbjct: 142 FRLANRIPLAKGKNVNEVEKKLLRVIPKEYLHDAHHWIILHGRHICT---AQRPRCRNCI 198

Query: 448 LEPFC 462
+ +C
Sbjct: 199 IYDYC 203


>tr|A3HV71|A3HV71_9SPHI Putative endonuclease OS=Algoriphagus sp.
PR1 GN=ALPR1_02340 PE=4 SV=1
Length = 221

Score = 35.4 bits (80), Expect = 1.7
Identities = 14/40 (35%), Positives = 23/40 (57%)
Frame = +1

Query: 346 PTDYVHISYHMVLSHGEHAQTPNFASRPPCRPSSLEPFCR 465
P +YVH+++H ++ HG + A +P C SL FC+
Sbjct: 171 PKEYVHVAHHWLILHGRYV---CLARKPKCEECSLTHFCK 207


>tr|B2W378|B2W378_PYRTR Putative uncharacterized protein
OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP)
GN=PTRG_03876 PE=4 SV=1
Length = 824

Score = 35.4 bits (80), Expect = 1.7
Identities = 16/49 (32%), Positives = 28/49 (57%)
Frame = -3

Query: 282 WCQLKFIHGRSYLAGDGAPKLPLFFGCMFSIINGWPPDYPIYLGYLCGD 136
WC + F+ R+ + GDG ++ L++ M++ I+ P I+LG L D
Sbjct: 71 WC-MHFVGNRAIVLGDGEKEIQLYYSPMYTAISAVLPVLVIFLGLLAAD 118


>tr|A0Q6Q7|A0Q6Q7_FRATN Endonuclease III OS=Francisella tularensis
subsp. novicida (strain U112) GN=nth PE=4 SV=1
Length = 212

Score = 33.9 bits (76), Expect = 5.0
Identities = 19/65 (29%), Positives = 29/65 (44%)
Frame = +1

Query: 268 FELAPRIDPPKEGSCRPHHHSRGSATPTDYVHISYHMVLSHGEHAQTPNFASRPPCRPSS 447
F LA RI K + P +Y+H ++H ++ HG + T A RP CR
Sbjct: 142 FRLANRIPLAKGKNVNEVEKKLLRVIPKEYLHDAHHWIILHGRYICT---AQRPKCRNCI 198

Query: 448 LEPFC 462
+ +C
Sbjct: 199 IYDYC 203


>tr|B4AUC3|B4AUC3_FRANO Endonuclease III OS=Francisella novicida FTE
GN=nth PE=4 SV=1
Length = 212

Score = 33.9 bits (76), Expect = 5.0
Identities = 19/65 (29%), Positives = 29/65 (44%)
Frame = +1

Query: 268 FELAPRIDPPKEGSCRPHHHSRGSATPTDYVHISYHMVLSHGEHAQTPNFASRPPCRPSS 447
F LA RI K + P +Y+H ++H ++ HG + T A RP CR
Sbjct: 142 FRLANRIPLAKGKNVNEVEKKLLRVIPKEYLHDAHHWIILHGRYICT---AQRPKCRNCI 198

Query: 448 LEPFC 462
+ +C
Sbjct: 199 IYDYC 203


>tr|A7JM74|A7JM74_FRANO Endonuclease III OS=Francisella novicida
GA99-3548 GN=FTDG_00610 PE=4 SV=1
Length = 212

Score = 33.9 bits (76), Expect = 5.0
Identities = 19/65 (29%), Positives = 29/65 (44%)
Frame = +1

Query: 268 FELAPRIDPPKEGSCRPHHHSRGSATPTDYVHISYHMVLSHGEHAQTPNFASRPPCRPSS 447
F LA RI K + P +Y+H ++H ++ HG + T A RP CR
Sbjct: 142 FRLANRIPLAKGKNVNEVEKKLLRVIPKEYLHDAHHWIILHGRYICT---AQRPKCRNCI 198

Query: 448 LEPFC 462
+ +C
Sbjct: 199 IYDYC 203


>tr|A7JI30|A7JI30_FRANO Putative uncharacterized protein
OS=Francisella novicida GA99-3549 GN=FTCG_00563 PE=4
SV=1
Length = 212

Score = 33.9 bits (76), Expect = 5.0
Identities = 19/65 (29%), Positives = 29/65 (44%)
Frame = +1

Query: 268 FELAPRIDPPKEGSCRPHHHSRGSATPTDYVHISYHMVLSHGEHAQTPNFASRPPCRPSS 447
F LA RI K + P +Y+H ++H ++ HG + T A RP CR
Sbjct: 142 FRLANRIPLAKGKNVNEVEKKLLRVIPKEYLHDAHHWIILHGRYICT---AQRPKCRNCI 198

Query: 448 LEPFC 462
+ +C
Sbjct: 199 IYDYC 203


>tr|Q5NH26|Q5NH26_FRATT Endonuclease III OS=Francisella tularensis
subsp. tularensis GN=nth PE=4 SV=1
Length = 212

Score = 33.5 bits (75), Expect = 6.5
Identities = 19/65 (29%), Positives = 29/65 (44%)
Frame = +1

Query: 268 FELAPRIDPPKEGSCRPHHHSRGSATPTDYVHISYHMVLSHGEHAQTPNFASRPPCRPSS 447
F LA RI K + P +Y+H ++H ++ HG + T A RP CR
Sbjct: 142 FRLANRIPLAKGKNVNEVEKKLLRVIPKEYLHDAHHWIILHGRYICT---AQRPRCRNCI 198

Query: 448 LEPFC 462
+ +C
Sbjct: 199 IYDYC 203


>tr|Q5L3K0|Q5L3K0_GEOKA Putative uncharacterized protein GK0195
OS=Geobacillus kaustophilus GN=GK0195 PE=4 SV=1
Length = 100

Score = 33.5 bits (75), Expect = 6.5
Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 5/45 (11%)
Frame = -2

Query: 373 DSLCG-HSPLVWRTPDYGGVVYRILP----SEDRFVVPAQIHPWS 254
D +CG HSP V RTPDY YR +P ++ R V P + P++
Sbjct: 2 DKVCGRHSPAVKRTPDYISQAYRCIPRCNLTDIRPVRPQKARPFA 46