BP911954
Clone id YMU001_000011_C04
Library
Length 512
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000011_C04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATTCTCACAAGTTAAACCAATGCCTTCAAATCATGCTGTCATTGTGTTGACCCCCCCTTG
CCAGCTTGGTGATGCCACAATGTGGACAAATTACATCTGTCAAATCTGGCATGAGATGTA
GCTCCTTAATTGACTTCATTCTTTCTTACTAATTGGTATTTACACAATTCCAATGTACAA
ACAAACTTCCCAACTCTTGCTTCAGACGCTATAAGCTGGTTCCAAGTTCGATCTTCTTCA
TAGTTTTACATTACAAGAAGCTTTATCATCAAATGTAGGATAAACTTTTTGAAGCAATTT
GGAGATCGCTTTACAAATTCCCTTCCACTGAATTTCCATCCAAAAGATCACAAGATCGAC
TTGCTTCAAGAGAGGTCCATTCAATCAAACTTTGATACAACAAAAAAGAAGGGTCCTTGT
GTGTATGTACAGATTTCACCATCCTTTATAGTTCAGTATCAGCAAATGGAGTAGCTGTAA
AAGTACACCATCACAGCAGCATTCAATAGCCA
■■Homology search results ■■ -
sp_hit_id P47066
Definition sp|P47066|YJC2_YEAST Putative uncharacterized protein YJL009W OS=Saccharomyces cerevisiae
Align length 36
Score (bit) 32.0
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911954|Adiantum capillus-veneris mRNA, clone:
YMU001_000011_C04.
(512 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P47066|YJC2_YEAST Putative uncharacterized protein YJL009W OS... 32 1.7
sp|O94669|AP3M_SCHPO AP-3 complex subunit mu OS=Schizosaccharomy... 31 3.8
sp|O63852|MSHM_SARGL Mitochondrial DNA mismatch repair protein m... 30 5.0
sp|Q36724|COX1_BLAGE Cytochrome c oxidase subunit 1 (Fragment) O... 30 6.5
sp|A1W0U9|HIS51_CAMJJ Imidazole glycerol phosphate synthase subu... 30 8.5

>sp|P47066|YJC2_YEAST Putative uncharacterized protein YJL009W
OS=Saccharomyces cerevisiae GN=YJL022W PE=5 SV=1
Length = 102

Score = 32.0 bits (71), Expect = 1.7
Identities = 13/36 (36%), Positives = 23/36 (63%)
Frame = +3

Query: 153 LVFTQFQCTNKLPNSCFRRYKLVPSSIFFIVLHYKK 260
+VF+ F+ T + P S FRR S+FF+ ++++K
Sbjct: 33 IVFSAFKHTAEFPESLFRRSPRERGSVFFVTINFEK 68


>sp|O94669|AP3M_SCHPO AP-3 complex subunit mu OS=Schizosaccharomyces
pombe GN=apm3 PE=2 SV=1
Length = 425

Score = 30.8 bits (68), Expect = 3.8
Identities = 20/52 (38%), Positives = 28/52 (53%)
Frame = +1

Query: 115 DVAP*LTSFFLTNWYLHNSNVQTNFPTLASDAISWFQVRSSS*FYITRSFII 270
D+ P L SF N ++ + +QTN PTLA D + W R++ Y T F I
Sbjct: 135 DIVP-LPSFM--NKFMAVTGLQTNTPTLARDTVPW---RTAKAKYATNEFFI 180


>sp|O63852|MSHM_SARGL Mitochondrial DNA mismatch repair protein mutS
homolog OS=Sarcophyton glaucum PE=3 SV=1
Length = 982

Score = 30.4 bits (67), Expect = 5.0
Identities = 16/37 (43%), Positives = 20/37 (54%)
Frame = -3

Query: 318 ICKAISKLLQKVYPTFDDKASCNVKL*RRSNLEPAYS 208
IC A + + + P + K CN KL RRSNL P S
Sbjct: 907 ICGAPADAVHHIKPKSEHKKLCNRKLNRRSNLVPVCS 943


>sp|Q36724|COX1_BLAGE Cytochrome c oxidase subunit 1 (Fragment)
OS=Blattella germanica GN=COI PE=2 SV=1
Length = 508

Score = 30.0 bits (66), Expect = 6.5
Identities = 13/29 (44%), Positives = 16/29 (55%)
Frame = +1

Query: 139 FFLTNWYLHNSNVQTNFPTLASDAISWFQ 225
F W +SN Q FPT S++I WFQ
Sbjct: 463 FIFIMWESMSSNRQVLFPTQTSNSIEWFQ 491


>sp|A1W0U9|HIS51_CAMJJ Imidazole glycerol phosphate synthase subunit
hisH 1 OS=Campylobacter jejuni subsp. jejuni serotype
O:23/36 (strain 81-176) GN=hisH1 PE=3 SV=1
Length = 201

Score = 29.6 bits (65), Expect = 8.5
Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 9/49 (18%)
Frame = +1

Query: 226 VRSSS*FYITRSFIIKCRINFLK---QFGDRFTNSL------PLNFHPK 345
+ + S FY SF +KC+ F+ Q+G +F SL FHP+
Sbjct: 137 INNKSDFYFVHSFYVKCKDEFVSAKAQYGHKFVASLQKDRIFATQFHPE 185


tr_hit_id A0CJ71
Definition tr|A0CJ71|A0CJ71_PARTE Chromosome undetermined scaffold_194, whole genome shotgun sequence OS=Paramecium tetraurelia
Align length 66
Score (bit) 33.1
E-value 8.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP911954|Adiantum capillus-veneris mRNA, clone:
YMU001_000011_C04.
(512 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A0CJ71|A0CJ71_PARTE Chromosome undetermined scaffold_194, who... 33 8.1

>tr|A0CJ71|A0CJ71_PARTE Chromosome undetermined scaffold_194, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00038620001 PE=4 SV=1
Length = 699

Score = 33.1 bits (74), Expect = 8.1
Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 2/66 (3%)
Frame = +1

Query: 145 LTNWYLHNSNVQTNFPTLASDAISWFQVRSSS*F--YITRSFIIKCRINFLKQFGDRFTN 318
+T++ +N N++ T A +ISWF +R S F YI + +C+ ++ F F+N
Sbjct: 311 ITDFIHNNENLRIEVTTSADGSISWFGIRDFSLFIDYIKEEY--QCKDFNIQPFDGCFSN 368

Query: 319 SLPLNF 336
NF
Sbjct: 369 QYDCNF 374