BP912047
Clone id YMU001_000012_D10
Library
Length 547
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000012_D10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCCAAAGGCATCTGCAGGGCTTGAGGTCGGAGCGAGGTCGAAAATGAAGGTTGTCGCCGC
GTACCTGCTACTGCTGCTCGGCGGCAAGGCAGCTCCAGGCCCTGAAGACATCAGGTCCAT
TCTTGGCTCTGTTGGAGCTGAGGTTGATGATGATAAACTTGACCTCTTTTTCAAGGAGTT
GGGAGGCAAGGATGTGAATGAAGTCCTAGCTCTAGGAAGGGAAAGGTTCGCAGCTGGTGG
TGGAGGCGGTGGGGGTATTGCAGTTGCTGCTGCCAGCAGCGGCGGTGGCGGTGGCGGTGC
TGCTGCTCCTGCTGCAGAGGAGGAGAAGGAAGAGAAGAAAGAAGAGAAGGAGGAATCTGA
TGATGACATGGGCTTCAGTCTCTTCGACTAAATTGTTATTCTTGTGATTCGACTACAACT
GGAAGTCTCATGGATGCTTTACAAGTCAATGAGATTTCAAACTTTGTATACTGGTTCTGG
CAATGAACTTGGCCAGGTTTTGGATAACTTTAATCATAGAGCAGTTTTGTGATCAACCCT
TTGTAGT
■■Homology search results ■■ -
sp_hit_id Q9SLF7
Definition sp|Q9SLF7|RLA22_ARATH 60S acidic ribosomal protein P2-2 OS=Arabidopsis thaliana
Align length 115
Score (bit) 57.0
E-value 6.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912047|Adiantum capillus-veneris mRNA, clone:
YMU001_000012_D10.
(547 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SLF7|RLA22_ARATH 60S acidic ribosomal protein P2-2 OS=Arabi... 57 6e-08
sp|P51407|RLA21_ARATH 60S acidic ribosomal protein P2-1 OS=Arabi... 55 3e-07
sp|P46252|RLA2A_MAIZE 60S acidic ribosomal protein P2A OS=Zea ma... 52 2e-06
sp|O24415|RLA2B_MAIZE 60S acidic ribosomal protein P2B OS=Zea ma... 51 3e-06
sp|P41099|RLA2_PARAR 60S acidic ribosomal protein P2 OS=Partheni... 49 2e-05
sp|Q9LXM8|RLA24_ARATH 60S acidic ribosomal protein P2-4 OS=Arabi... 47 6e-05
sp|O01725|RLA2_BRAFL 60S acidic ribosomal protein P2 OS=Branchio... 46 1e-04
sp|Q9C3Z5|RLA2_PODAN 60S acidic ribosomal protein P2 OS=Podospor... 45 2e-04
sp|P42039|RLA2_CLAHE 60S acidic ribosomal protein P2 OS=Cladospo... 45 3e-04
sp|P42037|RLA2_ALTAL 60S acidic ribosomal protein P2 OS=Alternar... 44 5e-04
sp|P05389|RLA2_DROME 60S acidic ribosomal protein P2 OS=Drosophi... 43 0.001
sp|P99027|RLA2_MOUSE 60S acidic ribosomal protein P2 OS=Mus musc... 42 0.003
sp|P05387|RLA2_HUMAN 60S acidic ribosomal protein P2 OS=Homo sap... 42 0.003
sp|Q6X9Z5|RLA2_HORSE 60S acidic ribosomal protein P2 OS=Equus ca... 41 0.003
sp|Q9LUK2|RLA25_ARATH 60S acidic ribosomal protein P2-5 OS=Arabi... 41 0.003
sp|Q96UQ7|RLA2_RHOGU 60S acidic ribosomal protein P2 OS=Rhodotor... 41 0.004
sp|P42899|RLA2_BOVIN 60S acidic ribosomal protein P2 OS=Bos taur... 41 0.004
sp|P02401|RLA2_RAT 60S acidic ribosomal protein P2 OS=Rattus nor... 40 0.006
sp|O61463|RLA2_CRYST 60S acidic ribosomal protein P2 OS=Cryptoch... 40 0.006
sp|P02400|RLA4_YEAST 60S acidic ribosomal protein P2-beta OS=Sac... 40 0.007
sp|Q9UUZ6|RLA2_ASPFU 60S acidic ribosomal protein P2 OS=Aspergil... 40 0.007
sp|P90703|RLA2_BRUMA 60S acidic ribosomal protein P2 OS=Brugia m... 40 0.010
sp|Q29315|RLA2_PIG 60S acidic ribosomal protein P2 OS=Sus scrofa... 39 0.013
sp|Q8TFM9|RLA2_FUSCU 60S acidic ribosomal protein P2 OS=Fusarium... 39 0.017
sp|Q9LH85|RLA23_ARATH 60S acidic ribosomal protein P2-3 OS=Arabi... 39 0.022
sp|Q9HFQ4|RLA4_CANAL 60S acidic ribosomal protein P2-B OS=Candid... 38 0.037
sp|P02399|RLA2_ARTSA 60S acidic ribosomal protein P2 OS=Artemia ... 38 0.037
sp|P50879|RLA2_TAESO 60S acidic ribosomal protein P2 OS=Taenia s... 37 0.082
sp|Q967Y9|RLA2_EIMTE 60S acidic ribosomal protein P2 OS=Eimeria ... 36 0.11
sp|Q9GPU2|RLA2_EUPRA 60S acidic ribosomal protein P2 OS=Euplotes... 35 0.31

>sp|Q9SLF7|RLA22_ARATH 60S acidic ribosomal protein P2-2
OS=Arabidopsis thaliana GN=RPP2B PE=1 SV=1
Length = 115

Score = 57.0 bits (136), Expect = 6e-08
Identities = 38/115 (33%), Positives = 47/115 (40%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MKVVAAY KA+P DI++ILGSVGAE E+ GKD+ E++A GRE
Sbjct: 1 MKVVAAYLLAVLSGKASPTSADIKTILGSVGAETEDSQIELLLKEVKGKDLAELIAAGRE 60

Query: 224 RFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDDMGFSLFD 388
+ DDDMGFSLF+
Sbjct: 61 KLASVPSGGGGGVAVASATSGGGGGGGASAAESKKEEKKEEKEESDDDMGFSLFE 115


>sp|P51407|RLA21_ARATH 60S acidic ribosomal protein P2-1
OS=Arabidopsis thaliana GN=RPP2A PE=2 SV=2
Length = 115

Score = 54.7 bits (130), Expect = 3e-07
Identities = 37/115 (32%), Positives = 46/115 (40%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MKVVAA+ KA+P DI+ ILGSVGAE E+ GKD+ E++A GRE
Sbjct: 1 MKVVAAFLLAVLSGKASPTTGDIKDILGSVGAETEDSQIELLLKEVKGKDLAELIAAGRE 60

Query: 224 RFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDDMGFSLFD 388
+ DDDMGFSLF+
Sbjct: 61 KLASVPSGGGGGVAVASATSGGGGGGGAPAAESKKEEKKEEKEESDDDMGFSLFE 115


>sp|P46252|RLA2A_MAIZE 60S acidic ribosomal protein P2A OS=Zea mays
GN=RPP2A PE=1 SV=3
Length = 112

Score = 52.0 bits (123), Expect = 2e-06
Identities = 36/115 (31%), Positives = 45/115 (39%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MK VAAY A+P +D+ +IL SVG EV +L GKD+ E++A GRE
Sbjct: 1 MKFVAAYLLAVLAGNASPSADDLTAILESVGCEVDNEKMELLLSQLSGKDITELIAAGRE 60

Query: 224 RFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDDMGFSLFD 388
+F DDDMGFSLFD
Sbjct: 61 KF---ASVPCGGGGVAVAAAAPAAGGAAPAAEAKKEEKVEEKEESDDDMGFSLFD 112


>sp|O24415|RLA2B_MAIZE 60S acidic ribosomal protein P2B OS=Zea mays
GN=RPP2B PE=1 SV=1
Length = 113

Score = 51.2 bits (121), Expect = 3e-06
Identities = 27/61 (44%), Positives = 34/61 (55%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MKV+AAY +P +D++SIL SVGAE EL KD+ EV+A GRE
Sbjct: 1 MKVIAAYLLAVLGGNTSPTADDVKSILESVGAEADEEKLEFLLTELKDKDITEVIAAGRE 60

Query: 224 R 226
R
Sbjct: 61 R 61


>sp|P41099|RLA2_PARAR 60S acidic ribosomal protein P2 OS=Parthenium
argentatum PE=3 SV=1
Length = 114

Score = 48.9 bits (115), Expect = 2e-05
Identities = 24/61 (39%), Positives = 35/61 (57%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MKV+AA+ +P ED++SIL SVGA+ ++ GKD+ E++A GRE
Sbjct: 1 MKVIAAFLLALLGGNTSPTDEDLKSILASVGADADDDKIELLLSQVKGKDITELIASGRE 60

Query: 224 R 226
R
Sbjct: 61 R 61


>sp|Q9LXM8|RLA24_ARATH 60S acidic ribosomal protein P2-4
OS=Arabidopsis thaliana GN=RPP2D PE=2 SV=1
Length = 111

Score = 47.0 bits (110), Expect = 6e-05
Identities = 23/61 (37%), Positives = 35/61 (57%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MKV AA+ A P ++I+ I+G+VGA+V E+ GKD+ E++A GRE
Sbjct: 1 MKVAAAFLLAVLGGNANPSADNIKDIIGAVGADVDGESIELLLKEVSGKDIAELIASGRE 60

Query: 224 R 226
+
Sbjct: 61 K 61


>sp|O01725|RLA2_BRAFL 60S acidic ribosomal protein P2
OS=Branchiostoma floridae PE=3 SV=1
Length = 116

Score = 45.8 bits (107), Expect = 1e-04
Identities = 25/59 (42%), Positives = 30/59 (50%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGR 220
M+ VAAY A P DI+ ILGSVG + EL GKD+ EV+A GR
Sbjct: 1 MRYVAAYLLAVLGGNANPSAGDIKKILGSVGIDAEDERLNKVIGELKGKDIEEVMAAGR 59


>sp|Q9C3Z5|RLA2_PODAN 60S acidic ribosomal protein P2 OS=Podospora
anserina PE=3 SV=1
Length = 111

Score = 45.1 bits (105), Expect = 2e-04
Identities = 24/61 (39%), Positives = 32/61 (52%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MK +AAY KA P D++++L SVG E EL GKDVNE++A G
Sbjct: 1 MKHLAAYLLLTLGGKATPSAADVKAVLESVGIEADSDRLDKLISELEGKDVNELIAEGSS 60

Query: 224 R 226
+
Sbjct: 61 K 61


>sp|P42039|RLA2_CLAHE 60S acidic ribosomal protein P2
OS=Cladosporium herbarum GN=CLAH5 PE=1 SV=3
Length = 111

Score = 44.7 bits (104), Expect = 3e-04
Identities = 21/61 (34%), Positives = 34/61 (55%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MK +AA+ ++P EDI+++L SVG + EL GKD+NE+++ G E
Sbjct: 1 MKYLAAFLLLGLAGNSSPSAEDIKTVLSSVGIDADEERLSSLLKELEGKDINELISSGSE 60

Query: 224 R 226
+
Sbjct: 61 K 61


>sp|P42037|RLA2_ALTAL 60S acidic ribosomal protein P2 OS=Alternaria
alternata GN=ALTA5 PE=1 SV=1
Length = 113

Score = 43.9 bits (102), Expect = 5e-04
Identities = 22/61 (36%), Positives = 32/61 (52%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MK +AAY +P D++++L SVG E EL GKD+NE++A G E
Sbjct: 1 MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGSE 60

Query: 224 R 226
+
Sbjct: 61 K 61


tr_hit_id A5X2V3
Definition tr|A5X2V3|A5X2V3_PTEVI Ribosomal protein (Fragment) OS=Pteris vittata
Align length 67
Score (bit) 82.8
E-value 1.0e-14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912047|Adiantum capillus-veneris mRNA, clone:
YMU001_000012_D10.
(547 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5X2V3|A5X2V3_PTEVI Ribosomal protein (Fragment) OS=Pteris vi... 83 1e-14
tr|A9U0Z9|A9U0Z9_PHYPA Predicted protein OS=Physcomitrella paten... 61 3e-08
tr|A9NWC8|A9NWC8_PICSI Putative uncharacterized protein OS=Picea... 60 8e-08
tr|A9RPY2|A9RPY2_PHYPA Predicted protein OS=Physcomitrella paten... 57 8e-07
tr|A9RV72|A9RV72_PHYPA Predicted protein OS=Physcomitrella paten... 56 1e-06
tr|B6DRE4|B6DRE4_9LAMI 60S acidic ribosomal protein P2-like prot... 55 3e-06
tr|B4FI88|B4FI88_MAIZE 60S acidic ribosomal protein P2A OS=Zea m... 55 3e-06
tr|A9RKJ0|A9RKJ0_PHYPA Predicted protein OS=Physcomitrella paten... 55 3e-06
tr|A9NPB9|A9NPB9_PICSI Putative uncharacterized protein OS=Picea... 55 3e-06
tr|Q7XYD5|Q7XYD5_WHEAT Acidic ribosomal protein (Fragment) OS=Tr... 54 5e-06
tr|A9S6G5|A9S6G5_PHYPA Predicted protein OS=Physcomitrella paten... 54 5e-06
tr|Q8H2B9|Q8H2B9_PRUDU 60s acidic ribosomal protein OS=Prunus du... 54 7e-06
tr|Q9SM26|Q9SM26_MAIZE 60S acidic ribosomal protein P2A OS=Zea m... 53 9e-06
tr|B6U978|B6U978_MAIZE 60S acidic ribosomal protein P2A OS=Zea m... 53 9e-06
tr|A5AGQ2|A5AGQ2_VITVI Putative uncharacterized protein (Chromos... 53 9e-06
tr|Q677G0|Q677G0_HYAOR Acidic ribosomal protein OS=Hyacinthus or... 53 1e-05
tr|Q65WT5|Q65WT5_ORYSJ Os05g0445500 protein OS=Oryza sativa subs... 53 1e-05
tr|B8AYR2|B8AYR2_ORYSI Putative uncharacterized protein OS=Oryza... 53 1e-05
tr|A3B4J3|A3B4J3_ORYSJ Putative uncharacterized protein OS=Oryza... 53 1e-05
tr|B8B8R7|B8B8R7_ORYSI Putative uncharacterized protein OS=Oryza... 52 2e-05
tr|A7QBE6|A7QBE6_VITVI Chromosome chr13 scaffold_74, whole genom... 52 2e-05
tr|A2YT04|A2YT04_ORYSI Putative uncharacterized protein OS=Oryza... 52 2e-05
tr|Q6YW11|Q6YW11_ORYSJ Putative 60S acidiic ribosomal protein P2... 52 2e-05
tr|B6SIT5|B6SIT5_MAIZE 60S acidic ribosomal protein P2A OS=Zea m... 52 2e-05
tr|B6SIG8|B6SIG8_MAIZE 60S acidic ribosomal protein P2A OS=Zea m... 52 2e-05
tr|B4FVI4|B4FVI4_MAIZE 60S acidic ribosomal protein P2A OS=Zea m... 52 2e-05
tr|A3BR69|A3BR69_ORYSJ Putative uncharacterized protein OS=Oryza... 52 2e-05
tr|Q5YJR8|Q5YJR8_HYAOR 60S acidic ribosomal protein OS=Hyacinthu... 52 3e-05
tr|Q3HVP0|Q3HVP0_SOLTU 60s acidic ribosomal protein-like protein... 51 3e-05
tr|B4FD78|B4FD78_MAIZE 60S acidic ribosomal protein P2B OS=Zea m... 51 3e-05

>tr|A5X2V3|A5X2V3_PTEVI Ribosomal protein (Fragment) OS=Pteris
vittata PE=2 SV=1
Length = 127

Score = 82.8 bits (203), Expect = 1e-14
Identities = 44/67 (65%), Positives = 47/67 (70%)
Frame = +2

Query: 29 GARSKMKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVL 208
GAR+KMKVVAAY KAAP P+DIRSILGSVGAE EL GKDVNEVL
Sbjct: 5 GARTKMKVVAAYLLALLGGKAAPSPDDIRSILGSVGAEADDDKLDLFFKELAGKDVNEVL 64

Query: 209 ALGRERF 229
ALGRE+F
Sbjct: 65 ALGREKF 71


>tr|A9U0Z9|A9U0Z9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_227340 PE=4 SV=1
Length = 115

Score = 61.2 bits (147), Expect = 3e-08
Identities = 40/115 (34%), Positives = 47/115 (40%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MKVVAAY +AP +DI SILG+VGAE EL GKD+ EV+A G+E
Sbjct: 1 MKVVAAYLLALLGGNSAPSAKDIESILGAVGAEADPSRISLLLKELEGKDILEVIAAGKE 60

Query: 224 RFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDDMGFSLFD 388
+F DDDMGFSLFD
Sbjct: 61 KFASVPSGGGGGIVVASGGGGGGAAAPAAEEKKEESKKEEEKEESDDDMGFSLFD 115


>tr|A9NWC8|A9NWC8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=4 SV=1
Length = 115

Score = 60.1 bits (144), Expect = 8e-08
Identities = 38/115 (33%), Positives = 47/115 (40%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
M+VVAAY + P EDI+SILGSVGA+ +L GKD+ EV+A GRE
Sbjct: 1 MRVVAAYLLAVLGGNSKPSSEDIKSILGSVGADADDEKIDFLLSQLDGKDITEVIASGRE 60

Query: 224 RFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDDMGFSLFD 388
+F D+DMGFSLFD
Sbjct: 61 KFASVPSGGGVAVAVSGGGGGGGAPAAAAEPEAKKEEKPEEKEESDEDMGFSLFD 115


>tr|A9RPY2|A9RPY2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_160332 PE=4 SV=1
Length = 114

Score = 56.6 bits (135), Expect = 8e-07
Identities = 39/115 (33%), Positives = 47/115 (40%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MKVVAAY A+P +DI ++LGSVGAE EL GKD+ EV+A G+E
Sbjct: 1 MKVVAAYLLCLLGGNASPSAKDIEAVLGSVGAEADSARVRLLLKELEGKDILEVIAAGKE 60

Query: 224 RFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDDMGFSLFD 388
+F DDDMGFSLFD
Sbjct: 61 KF-ASVPSGGGGGVVVASASAGSGGAAPAAEVKEEPKKEEEKEESDDDMGFSLFD 114


>tr|A9RV72|A9RV72_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_161175 PE=4 SV=1
Length = 114

Score = 56.2 bits (134), Expect = 1e-06
Identities = 40/115 (34%), Positives = 47/115 (40%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MKVVAAY +AP +DI SILG+VGAE EL GKD+ EV+A G+E
Sbjct: 1 MKVVAAYLLALLGGNSAPTAKDIESILGAVGAEADAARVSLLLKELEGKDILEVIAAGKE 60

Query: 224 RFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDDMGFSLFD 388
+F DDDMGFSLFD
Sbjct: 61 KF-ASVPSGGGGGVVVSSAGAGGGSAAPAAEEKEEAKKEEEKEESDDDMGFSLFD 114


>tr|B6DRE4|B6DRE4_9LAMI 60S acidic ribosomal protein P2-like protein
OS=Forsythia suspensa GN=RPLP2 PE=4 SV=1
Length = 115

Score = 54.7 bits (130), Expect = 3e-06
Identities = 34/115 (29%), Positives = 44/115 (38%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MKV+AAY A P +D++ IL SVGAE ++ GKD+ E++A GRE
Sbjct: 1 MKVIAAYLLAVLGGNACPSADDLKDILSSVGAEANDDQIGLLLTQVTGKDITELIAAGRE 60

Query: 224 RFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDDMGFSLFD 388
+ DDDMGFSLFD
Sbjct: 61 KLASVPAGGGAVAVASAGAGATGGAAAPAAAEPKKEEKVEEKEESDDDMGFSLFD 115


>tr|B4FI88|B4FI88_MAIZE 60S acidic ribosomal protein P2A OS=Zea mays
PE=4 SV=1
Length = 112

Score = 54.7 bits (130), Expect = 3e-06
Identities = 38/115 (33%), Positives = 45/115 (39%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MKVVAAY A+P ED+ IL SVG EV +L GKD+ E++A GRE
Sbjct: 1 MKVVAAYLLAVLAGNASPSAEDLTGILESVGCEVDNERMELLLSQLSGKDITELIAAGRE 60

Query: 224 RFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDDMGFSLFD 388
+F DDDMGFSLFD
Sbjct: 61 KF---ASVPCGGGGVAVAAGAPAAGGAAPAAEAKKEEKVEEKEESDDDMGFSLFD 112


>tr|A9RKJ0|A9RKJ0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_175904 PE=4 SV=1
Length = 114

Score = 54.7 bits (130), Expect = 3e-06
Identities = 38/115 (33%), Positives = 47/115 (40%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MKVVAAY ++P +DI +ILG+VGAE EL GKD+ EV+A G+E
Sbjct: 1 MKVVAAYLLALLGGNSSPSAKDIEAILGAVGAEADPSRVSLLLKELEGKDILEVIAAGKE 60

Query: 224 RFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDDMGFSLFD 388
+F DDDMGFSLFD
Sbjct: 61 KF-ASVPSGGGGGVVVASGGAAAAPAAAAAEAKEEPKKEEEKEESDDDMGFSLFD 114


>tr|A9NPB9|A9NPB9_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=4 SV=1
Length = 114

Score = 54.7 bits (130), Expect = 3e-06
Identities = 28/62 (45%), Positives = 36/62 (58%)
Frame = +2

Query: 44 MKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALGRE 223
MKVVAAY +P +DI+SILGSVG + +L GKD+ EV+A GRE
Sbjct: 1 MKVVAAYLLAVLGGNTSPSSDDIKSILGSVGVDSDDDKIDYLLSQLEGKDITEVIASGRE 60

Query: 224 RF 229
+F
Sbjct: 61 KF 62


>tr|Q7XYD5|Q7XYD5_WHEAT Acidic ribosomal protein (Fragment)
OS=Triticum aestivum PE=2 SV=1
Length = 138

Score = 53.9 bits (128), Expect = 5e-06
Identities = 27/64 (42%), Positives = 37/64 (57%)
Frame = +2

Query: 38 SKMKVVAAYXXXXXXXKAAPGPEDIRSILGSVGAEVXXXXXXXXXXELGGKDVNEVLALG 217
S MK++AAY ++P D+++IL SVGAE EL GKD+ EV+A G
Sbjct: 24 STMKLIAAYLLAYLGGNSSPSAADVKNILDSVGAEADEEKLEFLLAELKGKDITEVIASG 83

Query: 218 RERF 229
RE+F
Sbjct: 84 REKF 87