BP912084
Clone id YMU001_000012_H04
Library
Length 348
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000012_H04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CGACGTAGCCATGCATGCATCAGCTAATGAGCCAGGATTGACCCTGGGAGTAGCCTTGGT
AGGCCATAGAGAACCAGTATGGCTGTAACTTCGCAATGGCGCGTAAGCTTTTGAGATTCC
GTTCTCATATCAATAATGCTGTTACCAGCACCAATTCTGGGTTTACTGAAAATTATGTTC
ACAGTTTGCTCTTCGGACAAGCACAGGCCCCTTGTTTCTGGCATGTGGTGATGTCCCTCC
TTTTCTCCCTCCATAGCCTCATTCAGAGCTTGCCTCTGAACAAGCGACATTGGTATTTGC
TGCTCAATTTTCATATTCATTCCTTCGTAAAAATCCCGGATCTCATGA
■■Homology search results ■■ -
sp_hit_id P0C7Q8
Definition sp|P0C7Q8|Y1927_ARATH LIM and UIM domain-containing At1g19270 OS=Arabidopsis thaliana
Align length 114
Score (bit) 157.0
E-value 1.0e-38
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912084|Adiantum capillus-veneris mRNA, clone:
YMU001_000012_H04.
(348 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P0C7Q8|Y1927_ARATH LIM and UIM domain-containing At1g19270 OS... 157 1e-38
sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe ... 35 0.12
sp|Q73EM3|DNLJ_BACC1 DNA ligase OS=Bacillus cereus (strain ATCC ... 32 0.75
sp|P43604|YFJ6_YEAST Uncharacterized protein YFR026C OS=Saccharo... 31 2.2
sp|P22220|SPE1_AVESA Arginine decarboxylase OS=Avena sativa GN=S... 30 3.7
sp|P54541|PCCB_BACSU Putative propionyl-CoA carboxylase beta cha... 30 4.8
sp|Q6HP94|DNLJ_BACHK DNA ligase OS=Bacillus thuringiensis subsp.... 30 4.8
sp|Q63GS3|DNLJ_BACCZ DNA ligase OS=Bacillus cereus (strain ZK / ... 30 4.8
sp|Q81IP2|DNLJ_BACCR DNA ligase OS=Bacillus cereus (strain ATCC ... 30 4.8
sp|Q81ZG1|DNLJ_BACAN DNA ligase OS=Bacillus anthracis GN=ligA PE... 30 4.8
sp|A0R906|DNLJ_BACAH DNA ligase OS=Bacillus thuringiensis (strai... 30 4.8
sp|P53304|SLI1_YEAST N-acetyltransferase SLI1 OS=Saccharomyces c... 29 6.3
sp|Q9KDJ3|NADA_BACHD Quinolinate synthetase A OS=Bacillus halodu... 29 8.3
sp|Q3A0D8|GLMU_PELCD Bifunctional protein glmU OS=Pelobacter car... 29 8.3

>sp|P0C7Q8|Y1927_ARATH LIM and UIM domain-containing At1g19270
OS=Arabidopsis thaliana GN=At1g19270 PE=2 SV=1
Length = 532

Score = 157 bits (398), Expect = 1e-38
Identities = 75/114 (65%), Positives = 95/114 (83%)
Frame = -2

Query: 344 EIRDFYEGMNMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVNIIFS 165
+I++FYEG+NMK+EQ++P+ LV+RQALNEA EGEK GH+HMPETRGLCLSEEQTV+ +
Sbjct: 314 QIQNFYEGLNMKVEQEVPLLLVERQALNEAREGEKNGHYHMPETRGLCLSEEQTVSTVRK 373

Query: 164 KPRIGAGNSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH*LMHAWLR 3
+ + G G ++ TE KLTR CEVTAIL+L+GLPRLL GSILAH +MHAW+R
Sbjct: 374 RSKHGTGKWAGNI-TEPYKLTRQCEVTAILILFGLPRLLTGSILAHEMMHAWMR 426


>sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe
GN=sen1 PE=1 SV=1
Length = 1687

Score = 35.0 bits (79), Expect = 0.12
Identities = 20/54 (37%), Positives = 33/54 (61%)
Frame = +3

Query: 87 NFAMARKLLRFRSHINNAVTSTNSGFTENYVHSLLFGQAQAPCFWHVVMSLLFS 248
+F A +++RF S N +++S NS FTEN + +L A C W+ ++ L+FS
Sbjct: 575 SFFPALRIMRFLSITNKSLSSDNSAFTENDIPTL---GAYWQCIWN-ILDLVFS 624


>sp|Q73EM3|DNLJ_BACC1 DNA ligase OS=Bacillus cereus (strain ATCC
10987) GN=ligA PE=3 SV=1
Length = 669

Score = 32.3 bits (72), Expect = 0.75
Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 2/99 (2%)
Frame = -2

Query: 317 NMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVN--IIFSKPRIGAG 144
N+K + IP+ L NE + E G +MP+ + L+EE+ N +F+ PR A
Sbjct: 149 NLKTIKAIPLRL------NEEVTLEARGEAYMPKRSFVKLNEEKEQNGEDVFANPRNAAA 202

Query: 143 NSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH 27
SI R K+ ++ + +YGL + +IL+H
Sbjct: 203 GSI---RQLDPKIAAKRNLS--MFVYGLANVEEKTILSH 236


>sp|P43604|YFJ6_YEAST Uncharacterized protein YFR026C
OS=Saccharomyces cerevisiae GN=YFR026C PE=1 SV=1
Length = 169

Score = 30.8 bits (68), Expect = 2.2
Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 2/34 (5%)
Frame = -3

Query: 256 LWREKRRDITTCQK--QGACACPKSKL*T*FSVN 161
LW EK+ D CQ+ +GAC+C K FSVN
Sbjct: 122 LWPEKKEDEKNCQETFKGACSCTKRFCKGYFSVN 155


>sp|P22220|SPE1_AVESA Arginine decarboxylase OS=Avena sativa GN=SPE1
PE=1 SV=1
Length = 607

Score = 30.0 bits (66), Expect = 3.7
Identities = 11/24 (45%), Positives = 16/24 (66%)
Frame = +3

Query: 276 LNKRHWYLLLNFHIHSFVKIPDLM 347
LNK HW LL+FH+ S + D++
Sbjct: 241 LNKLHWLKLLHFHVGSMIPTTDIV 264


>sp|P54541|PCCB_BACSU Putative propionyl-CoA carboxylase beta chain
OS=Bacillus subtilis GN=yqjD PE=3 SV=1
Length = 506

Score = 29.6 bits (65), Expect = 4.8
Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%)
Frame = -2

Query: 191 EQTVNIIFSKPRIGAGNSIIDMRTESQKLTRHCEV--TAILVLYGLPRLLPG 42
E+ + I+ S+P+ AG+ ID ++ + R C+ +L + +P LPG
Sbjct: 308 EKAIGIVASQPKHLAGSLTIDAADKAARFIRFCDAFDIPLLTVEDVPGFLPG 359


>sp|Q6HP94|DNLJ_BACHK DNA ligase OS=Bacillus thuringiensis subsp.
konkukian GN=ligA PE=3 SV=1
Length = 669

Score = 29.6 bits (65), Expect = 4.8
Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 2/99 (2%)
Frame = -2

Query: 317 NMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVN--IIFSKPRIGAG 144
N+K + IP+ L NE + E G +MP+ + L+EE+ N +F+ PR A
Sbjct: 149 NLKTIKAIPLRL------NEEVTLEARGEAYMPKRSFVKLNEEKEQNGEDVFANPRNAAA 202

Query: 143 NSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH 27
SI R K+ ++ + +YGL + +I +H
Sbjct: 203 GSI---RQLDPKIAAKRNLS--MFVYGLANVEEKTIPSH 236


>sp|Q63GS3|DNLJ_BACCZ DNA ligase OS=Bacillus cereus (strain ZK /
E33L) GN=ligA PE=3 SV=1
Length = 669

Score = 29.6 bits (65), Expect = 4.8
Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 2/99 (2%)
Frame = -2

Query: 317 NMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVN--IIFSKPRIGAG 144
N+K + IP+ L NE + E G +MP+ + L+EE+ N +F+ PR A
Sbjct: 149 NLKTIKAIPLRL------NEEVTLEARGEAYMPKRSFVKLNEEKEQNGEDVFANPRNAAA 202

Query: 143 NSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH 27
SI R K+ ++ + +YGL + +I +H
Sbjct: 203 GSI---RQLDPKIAAKRNLS--MFVYGLANVEEKTIPSH 236


>sp|Q81IP2|DNLJ_BACCR DNA ligase OS=Bacillus cereus (strain ATCC
14579 / DSM 31) GN=ligA PE=3 SV=1
Length = 669

Score = 29.6 bits (65), Expect = 4.8
Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 2/99 (2%)
Frame = -2

Query: 317 NMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVN--IIFSKPRIGAG 144
N+K + IP+ L NE + E G +MP+ + L+EE+ N +F+ PR A
Sbjct: 149 NLKTIKAIPLRL------NEEVTLEARGEAYMPKRSFVKLNEEKEQNGEDVFANPRNAAA 202

Query: 143 NSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH 27
SI R K+ ++ + +YGL + +I +H
Sbjct: 203 GSI---RQLDPKIAAKRNLS--MFVYGLANVEEKTIPSH 236


>sp|Q81ZG1|DNLJ_BACAN DNA ligase OS=Bacillus anthracis GN=ligA PE=3
SV=1
Length = 669

Score = 29.6 bits (65), Expect = 4.8
Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 2/99 (2%)
Frame = -2

Query: 317 NMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVN--IIFSKPRIGAG 144
N+K + IP+ L NE + E G +MP+ + L+EE+ N +F+ PR A
Sbjct: 149 NLKTIKAIPLRL------NEEVTLEARGEAYMPKRSFVKLNEEKEQNGEDVFANPRNAAA 202

Query: 143 NSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH 27
SI R K+ ++ + +YGL + +I +H
Sbjct: 203 GSI---RQLDPKIAAKRNLS--MFVYGLANVEEKTIPSH 236


tr_hit_id B8LR15
Definition tr|B8LR15|B8LR15_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 114
Score (bit) 189.0
E-value 5.0e-47
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912084|Adiantum capillus-veneris mRNA, clone:
YMU001_000012_H04.
(348 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LR15|B8LR15_PICSI Putative uncharacterized protein OS=Picea... 189 5e-47
tr|A7PV25|A7PV25_VITVI Chromosome chr4 scaffold_32, whole genome... 183 4e-45
tr|Q84Q71|Q84Q71_ORYSJ Putative uncharacterized protein OJA1364E... 182 6e-45
tr|Q10NJ6|Q10NJ6_ORYSJ Os03g0267800 protein OS=Oryza sativa subs... 182 6e-45
tr|A2XEY0|A2XEY0_ORYSI Putative uncharacterized protein OS=Oryza... 182 6e-45
tr|Q8W4F0|Q8W4F0_ARATH Putative uncharacterized protein (Putativ... 181 1e-44
tr|A7NTJ6|A7NTJ6_VITVI Chromosome chr18 scaffold_1, whole genome... 181 2e-44
tr|Q5SMM0|Q5SMM0_ORYSJ Os06g0182500 protein OS=Oryza sativa subs... 178 1e-43
tr|B8B3H9|B8B3H9_ORYSI Putative uncharacterized protein OS=Oryza... 178 1e-43
tr|A3B910|A3B910_ORYSJ Putative uncharacterized protein OS=Oryza... 178 1e-43
tr|B8A0A1|B8A0A1_MAIZE Putative uncharacterized protein OS=Zea m... 177 3e-43
tr|B8A2T6|B8A2T6_MAIZE Putative uncharacterized protein OS=Zea m... 173 3e-42
tr|B4FAN8|B4FAN8_MAIZE Putative uncharacterized protein OS=Zea m... 173 3e-42
tr|Q0WSN2|Q0WSN2_ARATH Putative uncharacterized protein At2g3983... 171 1e-41
tr|A7PV24|A7PV24_VITVI Chromosome chr4 scaffold_32, whole genome... 171 2e-41
tr|Q5KQN4|Q5KQN4_ORYSJ Putative LIM domain containing protein (L... 160 2e-38
tr|Q5KQN3|Q5KQN3_ORYSJ Putative LIM domain containing protein (L... 160 2e-38
tr|Q0DQ72|Q0DQ72_ORYSJ Os03g0626600 protein (Fragment) OS=Oryza ... 160 2e-38
tr|B8AMN9|B8AMN9_ORYSI Putative uncharacterized protein OS=Oryza... 160 2e-38
tr|A3AKK6|A3AKK6_ORYSJ Putative uncharacterized protein OS=Oryza... 160 2e-38
tr|B6SVV3|B6SVV3_MAIZE Zinc ion binding protein OS=Zea mays PE=2... 159 9e-38
tr|B6SPK3|B6SPK3_MAIZE Zinc ion binding protein OS=Zea mays PE=2... 159 9e-38
tr|Q8W5D0|Q8W5D0_ORYSA Putative uncharacterized protein OSJNBb00... 158 1e-37
tr|Q2QMP4|Q2QMP4_ORYSJ Os12g0596800 protein OS=Oryza sativa subs... 157 2e-37
tr|A3CJ37|A3CJ37_ORYSJ Putative uncharacterized protein OS=Oryza... 157 2e-37
tr|Q3E9P8|Q3E9P8_ARATH Uncharacterized protein At4g36860.2 OS=Ar... 156 6e-37
tr|O23197|O23197_ARATH Putative uncharacterized protein C7A10.50... 156 6e-37
tr|A9U002|A9U002_PHYPA Predicted protein (Fragment) OS=Physcomit... 144 2e-33
tr|A9TYD2|A9TYD2_PHYPA Predicted protein (Fragment) OS=Physcomit... 141 1e-32
tr|A9TME0|A9TME0_PHYPA Predicted protein (Fragment) OS=Physcomit... 137 3e-31

>tr|B8LR15|B8LR15_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 478

Score = 189 bits (481), Expect = 5e-47
Identities = 96/114 (84%), Positives = 102/114 (89%)
Frame = -2

Query: 344 EIRDFYEGMNMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVNIIFS 165
EIRDFYEGMNMKI QQIPM LV+RQALNEAM+GEKEG HHMPETRGLCLSEEQTV+ I
Sbjct: 257 EIRDFYEGMNMKINQQIPMLLVERQALNEAMQGEKEGSHHMPETRGLCLSEEQTVSSISR 316

Query: 164 KPRIGAGNSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH*LMHAWLR 3
+PRIG GN IIDM TES+KLTR CEVTAIL+LYGLPRLL GSILAH LMHAWLR
Sbjct: 317 RPRIG-GNRIIDMFTESKKLTRRCEVTAILILYGLPRLLTGSILAHELMHAWLR 369


>tr|A7PV25|A7PV25_VITVI Chromosome chr4 scaffold_32, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00025021001
PE=4 SV=1
Length = 465

Score = 183 bits (464), Expect = 4e-45
Identities = 86/114 (75%), Positives = 99/114 (86%)
Frame = -2

Query: 344 EIRDFYEGMNMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVNIIFS 165
EI++FYEG+NMK+EQQ+P+ LV+RQALNEAMEGEK GHHH+PETRGLCLSEEQTV+ I
Sbjct: 259 EIQEFYEGLNMKVEQQVPLLLVERQALNEAMEGEKNGHHHLPETRGLCLSEEQTVSTISG 318

Query: 164 KPRIGAGNSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH*LMHAWLR 3
+PRIG G IIDM TE +L R CEVTAIL+LYGLPRLL GSILAH +MHAWLR
Sbjct: 319 RPRIGTGYRIIDMMTEPYRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLR 372


>tr|Q84Q71|Q84Q71_ORYSJ Putative uncharacterized protein
OJA1364E02.5 (Putative uncharacterized protein) OS=Oryza
sativa subsp. japonica GN=OJA1364E02.5 PE=4 SV=1
Length = 496

Score = 182 bits (463), Expect = 6e-45
Identities = 89/115 (77%), Positives = 100/115 (86%)
Frame = -2

Query: 347 HEIRDFYEGMNMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVNIIF 168
H IRD+YEGMNMK++QQIPM LV+RQALNEAMEGE +G HHMPETRGLCLSEEQTV I
Sbjct: 269 HSIRDYYEGMNMKLDQQIPMLLVERQALNEAMEGESKGPHHMPETRGLCLSEEQTVTSIL 328

Query: 167 SKPRIGAGNSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH*LMHAWLR 3
+PRIGA N ++DM+T+ QKLTR CEVTAILVL+GLPRLL GSILAH LMH WLR
Sbjct: 329 RRPRIGA-NRLLDMKTQPQKLTRRCEVTAILVLFGLPRLLTGSILAHELMHGWLR 382


>tr|Q10NJ6|Q10NJ6_ORYSJ Os03g0267800 protein OS=Oryza sativa subsp.
japonica GN=Os03g0267800 PE=4 SV=1
Length = 501

Score = 182 bits (463), Expect = 6e-45
Identities = 89/115 (77%), Positives = 100/115 (86%)
Frame = -2

Query: 347 HEIRDFYEGMNMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVNIIF 168
H IRD+YEGMNMK++QQIPM LV+RQALNEAMEGE +G HHMPETRGLCLSEEQTV I
Sbjct: 274 HSIRDYYEGMNMKLDQQIPMLLVERQALNEAMEGESKGPHHMPETRGLCLSEEQTVTSIL 333

Query: 167 SKPRIGAGNSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH*LMHAWLR 3
+PRIGA N ++DM+T+ QKLTR CEVTAILVL+GLPRLL GSILAH LMH WLR
Sbjct: 334 RRPRIGA-NRLLDMKTQPQKLTRRCEVTAILVLFGLPRLLTGSILAHELMHGWLR 387


>tr|A2XEY0|A2XEY0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10896 PE=4 SV=1
Length = 496

Score = 182 bits (463), Expect = 6e-45
Identities = 89/115 (77%), Positives = 100/115 (86%)
Frame = -2

Query: 347 HEIRDFYEGMNMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVNIIF 168
H IRD+YEGMNMK++QQIPM LV+RQALNEAMEGE +G HHMPETRGLCLSEEQTV I
Sbjct: 269 HSIRDYYEGMNMKLDQQIPMLLVERQALNEAMEGESKGPHHMPETRGLCLSEEQTVTSIL 328

Query: 167 SKPRIGAGNSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH*LMHAWLR 3
+PRIGA N ++DM+T+ QKLTR CEVTAILVL+GLPRLL GSILAH LMH WLR
Sbjct: 329 RRPRIGA-NRLLDMKTQPQKLTRRCEVTAILVLFGLPRLLTGSILAHELMHGWLR 382


>tr|Q8W4F0|Q8W4F0_ARATH Putative uncharacterized protein (Putative
uncharacterized protein At4g36860) OS=Arabidopsis
thaliana GN=At4g36860 PE=2 SV=1
Length = 553

Score = 181 bits (460), Expect = 1e-44
Identities = 86/114 (75%), Positives = 98/114 (85%)
Frame = -2

Query: 344 EIRDFYEGMNMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVNIIFS 165
EIR+FYEG++MK+EQQIPM LV+R ALNEAMEGEK GHHH+PETRGLCLSEEQTV +
Sbjct: 332 EIREFYEGLHMKVEQQIPMLLVERSALNEAMEGEKHGHHHLPETRGLCLSEEQTVTTVLR 391

Query: 164 KPRIGAGNSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH*LMHAWLR 3
+PRIGAG +IDM TE +L R CEVTAIL+LYGLPRLL GSILAH +MHAWLR
Sbjct: 392 RPRIGAGYKLIDMITEPCRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLR 445


>tr|A7NTJ6|A7NTJ6_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00014692001
PE=4 SV=1
Length = 479

Score = 181 bits (459), Expect = 2e-44
Identities = 82/114 (71%), Positives = 101/114 (88%)
Frame = -2

Query: 344 EIRDFYEGMNMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVNIIFS 165
+I++FYEG+NMK++QQ+P+ LV+RQALNEAMEGEK GHHHMPETRGLCLSEEQTV+ I
Sbjct: 261 DIQEFYEGLNMKVQQQVPLLLVERQALNEAMEGEKSGHHHMPETRGLCLSEEQTVSTILR 320

Query: 164 KPRIGAGNSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH*LMHAWLR 3
+P+IG GN +++M TE KLTR C+VTA+L+LYGLPRLL GSILAH +MHAWLR
Sbjct: 321 RPKIGTGNRVMNMITEPCKLTRRCDVTAVLILYGLPRLLTGSILAHEMMHAWLR 374


>tr|Q5SMM0|Q5SMM0_ORYSJ Os06g0182500 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0036B04.6 PE=4 SV=1
Length = 486

Score = 178 bits (452), Expect = 1e-43
Identities = 84/114 (73%), Positives = 101/114 (88%)
Frame = -2

Query: 344 EIRDFYEGMNMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVNIIFS 165
EI++FYEG+NMK+EQQ+P+ LV+RQALNEAMEGEK GHHH+PETRGLCLSEEQTV+ I
Sbjct: 266 EIQEFYEGLNMKVEQQVPLLLVERQALNEAMEGEKTGHHHLPETRGLCLSEEQTVSTILR 325

Query: 164 KPRIGAGNSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH*LMHAWLR 3
+PR+ AGN +++M TE +LTR CEVTAIL+LYGLPRLL GSILAH +MHAWLR
Sbjct: 326 RPRM-AGNKVMEMITEPYRLTRRCEVTAILILYGLPRLLTGSILAHEMMHAWLR 378


>tr|B8B3H9|B8B3H9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_21924 PE=4 SV=1
Length = 878

Score = 178 bits (452), Expect = 1e-43
Identities = 84/114 (73%), Positives = 101/114 (88%)
Frame = -2

Query: 344 EIRDFYEGMNMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVNIIFS 165
EI++FYEG+NMK+EQQ+P+ LV+RQALNEAMEGEK GHHH+PETRGLCLSEEQTV+ I
Sbjct: 658 EIQEFYEGLNMKVEQQVPLLLVERQALNEAMEGEKTGHHHLPETRGLCLSEEQTVSTILR 717

Query: 164 KPRIGAGNSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH*LMHAWLR 3
+PR+ AGN +++M TE +LTR CEVTAIL+LYGLPRLL GSILAH +MHAWLR
Sbjct: 718 RPRM-AGNKVMEMITEPYRLTRRCEVTAILILYGLPRLLTGSILAHEMMHAWLR 770


>tr|A3B910|A3B910_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_019532 PE=4 SV=1
Length = 877

Score = 178 bits (452), Expect = 1e-43
Identities = 84/114 (73%), Positives = 101/114 (88%)
Frame = -2

Query: 344 EIRDFYEGMNMKIEQQIPMSLVQRQALNEAMEGEKEGHHHMPETRGLCLSEEQTVNIIFS 165
EI++FYEG+NMK+EQQ+P+ LV+RQALNEAMEGEK GHHH+PETRGLCLSEEQTV+ I
Sbjct: 657 EIQEFYEGLNMKVEQQVPLLLVERQALNEAMEGEKTGHHHLPETRGLCLSEEQTVSTILR 716

Query: 164 KPRIGAGNSIIDMRTESQKLTRHCEVTAILVLYGLPRLLPGSILAH*LMHAWLR 3
+PR+ AGN +++M TE +LTR CEVTAIL+LYGLPRLL GSILAH +MHAWLR
Sbjct: 717 RPRM-AGNKVMEMITEPYRLTRRCEVTAILILYGLPRLLTGSILAHEMMHAWLR 769