BP912095
Clone id YMU001_000015_A10
Library
Length 331
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000015_A10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATATACAGATTGCAATCCAACGACTAGTCCATTATGCTAAAGCCAATTGGCATGAGAGTG
GCAGAACTCTTTCTTCCATTCCAAAAGTTACAAAGCCTAACATTGGTCTAAGCTAAGTAG
CAAAGTATTCGATGGAAAAGACGCCCCCTCTAAAAAGTATCCCTTATCATATGGCAGCCC
TCACTGCTTCTCTTCTGATATGAGCAGCCTTACCAGAACCTCGGAAGTACATATATACTT
GCTTTAGAACCCACAAGCTGAGCAGGGCTTCCAAAACAAAGCAAACTGTACCGACAATGT
AGAATATCCCGACCAATGTCGAATCCGAAAA
■■Homology search results ■■ -
sp_hit_id Q8H5X5
Definition sp|Q8H5X5|SCAM1_ORYSJ Secretory carrier-associated membrane protein 1 OS=Oryza sativa subsp. japonica
Align length 40
Score (bit) 59.7
E-value 4.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912095|Adiantum capillus-veneris mRNA, clone:
YMU001_000015_A10.
(331 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8H5X5|SCAM1_ORYSJ Secretory carrier-associated membrane prot... 60 4e-09
sp|A2YMP7|SCAM1_ORYSI Putative secretory carrier-associated memb... 60 4e-09
sp|Q9SKT3|SCAM1_ARATH Secretory carrier-associated membrane prot... 59 1e-08
sp|Q9M5P2|SCAM3_ARATH Secretory carrier-associated membrane prot... 58 2e-08
sp|Q9ZTX0|SCAM_PEA Secretory carrier-associated membrane protein... 57 2e-08
sp|Q6Z8F5|SCAM5_ORYSJ Secretory carrier-associated membrane prot... 57 2e-08
sp|Q9SXA5|SCAM5_ARATH Secretory carrier-associated membrane prot... 57 2e-08
sp|Q75IC7|SCAM4_ORYSJ Secretory carrier-associated membrane prot... 56 5e-08
sp|Q9C6X2|SCAM4_ARATH Secretory carrier-associated membrane prot... 55 8e-08
sp|Q60EA5|SCAM3_ORYSJ Secretory carrier-associated membrane prot... 55 1e-07
sp|Q7F613|SCAM2_ORYSJ Secretory carrier-associated membrane prot... 53 4e-07
sp|Q0JAI9|SCAM6_ORYSJ Secretory carrier-associated membrane prot... 52 9e-07
sp|Q9LR68|SCAM2_ARATH Secretory carrier-associated membrane prot... 51 2e-06
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Sch... 30 4.9

>sp|Q8H5X5|SCAM1_ORYSJ Secretory carrier-associated membrane protein
1 OS=Oryza sativa subsp. japonica GN=SCAMP1 PE=2 SV=1
Length = 306

Score = 59.7 bits (143), Expect = 4e-09
Identities = 27/40 (67%), Positives = 33/40 (82%)
Frame = -1

Query: 328 SDSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
S + LVGIFY VG F +E+LLS+WV++QVYMYFRGSGK
Sbjct: 250 SKNALVGIFYFVGFGLFCVESLLSIWVIQQVYMYFRGSGK 289


>sp|A2YMP7|SCAM1_ORYSI Putative secretory carrier-associated
membrane protein 1 OS=Oryza sativa subsp. indica
GN=SCAMP1 PE=3 SV=1
Length = 306

Score = 59.7 bits (143), Expect = 4e-09
Identities = 27/40 (67%), Positives = 33/40 (82%)
Frame = -1

Query: 328 SDSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
S + LVGIFY VG F +E+LLS+WV++QVYMYFRGSGK
Sbjct: 250 SKNALVGIFYFVGFGLFCVESLLSIWVIQQVYMYFRGSGK 289


>sp|Q9SKT3|SCAM1_ARATH Secretory carrier-associated membrane protein
1 OS=Arabidopsis thaliana GN=SCAMP1 PE=1 SV=1
Length = 282

Score = 58.5 bits (140), Expect = 1e-08
Identities = 26/40 (65%), Positives = 33/40 (82%)
Frame = -1

Query: 328 SDSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
S + LVGIFY +G F LE+L+S+WV++QVYMYFRGSGK
Sbjct: 226 SGNILVGIFYFIGFGFFCLESLVSIWVIQQVYMYFRGSGK 265


>sp|Q9M5P2|SCAM3_ARATH Secretory carrier-associated membrane protein
3 OS=Arabidopsis thaliana GN=SCAMP3 PE=1 SV=1
Length = 289

Score = 57.8 bits (138), Expect = 2e-08
Identities = 24/40 (60%), Positives = 32/40 (80%)
Frame = -1

Query: 328 SDSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
S +VGIFY +G F LE+++S+WV++QVYMYFRGSGK
Sbjct: 233 SGQAIVGIFYFIGFAFFCLESVVSIWVIQQVYMYFRGSGK 272


>sp|Q9ZTX0|SCAM_PEA Secretory carrier-associated membrane protein
OS=Pisum sativum GN=PSAM2 PE=2 SV=1
Length = 289

Score = 57.4 bits (137), Expect = 2e-08
Identities = 25/39 (64%), Positives = 31/39 (79%)
Frame = -1

Query: 325 DSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
D TLVGIFY +G F LE L+S+WV++QVYM+FRG GK
Sbjct: 233 DYTLVGIFYFIGFGFFCLETLISIWVIQQVYMHFRGGGK 271


>sp|Q6Z8F5|SCAM5_ORYSJ Secretory carrier-associated membrane protein
5 OS=Oryza sativa subsp. japonica GN=SCAMP5 PE=2 SV=1
Length = 281

Score = 57.4 bits (137), Expect = 2e-08
Identities = 25/38 (65%), Positives = 30/38 (78%)
Frame = -1

Query: 331 FSDSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRG 218
FSD +VGIFY VG F LE L+S+WVL++VYMYFRG
Sbjct: 242 FSDHAIVGIFYFVGFALFCLETLVSIWVLQKVYMYFRG 279


>sp|Q9SXA5|SCAM5_ARATH Secretory carrier-associated membrane protein
5 OS=Arabidopsis thaliana GN=SCAMP5 PE=2 SV=2
Length = 291

Score = 57.4 bits (137), Expect = 2e-08
Identities = 25/40 (62%), Positives = 32/40 (80%)
Frame = -1

Query: 328 SDSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
S LVGIFY +G F LE+++S+WV++QVYMYFRGSGK
Sbjct: 235 SAQALVGIFYFIGFGLFCLESVVSIWVIQQVYMYFRGSGK 274


>sp|Q75IC7|SCAM4_ORYSJ Secretory carrier-associated membrane protein
4 OS=Oryza sativa subsp. japonica GN=SCAMP4 PE=2 SV=1
Length = 313

Score = 56.2 bits (134), Expect = 5e-08
Identities = 22/39 (56%), Positives = 33/39 (84%)
Frame = -1

Query: 325 DSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
++ +VG+FY +G F LE+LLS+WV+++VY+YFRGSGK
Sbjct: 258 NTVIVGVFYFLGFAMFCLESLLSMWVIQRVYLYFRGSGK 296


>sp|Q9C6X2|SCAM4_ARATH Secretory carrier-associated membrane protein
4 OS=Arabidopsis thaliana GN=SCAMP4 PE=2 SV=1
Length = 264

Score = 55.5 bits (132), Expect = 8e-08
Identities = 24/38 (63%), Positives = 31/38 (81%)
Frame = -1

Query: 328 SDSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGS 215
SDS L GIFY +G F LE+LLSLWVL+++Y+YFRG+
Sbjct: 226 SDSLLAGIFYFIGFGLFCLESLLSLWVLQKIYLYFRGN 263


>sp|Q60EA5|SCAM3_ORYSJ Secretory carrier-associated membrane protein
3 OS=Oryza sativa subsp. japonica GN=SCAMP3 PE=2 SV=1
Length = 282

Score = 55.1 bits (131), Expect = 1e-07
Identities = 26/38 (68%), Positives = 31/38 (81%)
Frame = -1

Query: 322 STLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
S +VGIFY VG F LE+LLS+ V++QVYMYFRGSGK
Sbjct: 228 SAIVGIFYFVGFGLFCLESLLSIGVIQQVYMYFRGSGK 265


tr_hit_id A9TRH7
Definition tr|A9TRH7|A9TRH7_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 41
Score (bit) 63.9
E-value 4.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912095|Adiantum capillus-veneris mRNA, clone:
YMU001_000015_A10.
(331 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TRH7|A9TRH7_PHYPA Predicted protein OS=Physcomitrella paten... 64 4e-09
tr|B6TQ03|B6TQ03_MAIZE SC3 protein OS=Zea mays PE=2 SV=1 61 2e-08
tr|B7FIP0|B7FIP0_MEDTR Putative uncharacterized protein OS=Medic... 61 3e-08
tr|B3TLU6|B3TLU6_ELAGV Secretory carrier membrane protein OS=Ela... 61 3e-08
tr|A9S5T7|A9S5T7_PHYPA Predicted protein OS=Physcomitrella paten... 61 3e-08
tr|B6U711|B6U711_MAIZE SC3 protein OS=Zea mays PE=2 SV=1 60 4e-08
tr|B7X6S6|B7X6S6_TOBAC Secretory carrier-associated membrane pro... 60 6e-08
tr|B6TAX3|B6TAX3_MAIZE SC3 protein OS=Zea mays PE=2 SV=1 60 6e-08
tr|B4FNI8|B4FNI8_MAIZE Putative uncharacterized protein OS=Zea m... 60 6e-08
tr|A9PF06|A9PF06_POPTR Putative uncharacterized protein OS=Popul... 60 6e-08
tr|A7PXE4|A7PXE4_VITVI Chromosome chr12 scaffold_36, whole genom... 60 6e-08
tr|B7E5U7|B7E5U7_ORYSJ cDNA clone:006-207-G10, full insert seque... 60 7e-08
tr|B7FIN0|B7FIN0_MEDTR Putative uncharacterized protein OS=Medic... 58 2e-07
tr|B7EZ37|B7EZ37_ORYSJ cDNA clone:001-208-F01, full insert seque... 57 4e-07
tr|B6TM90|B6TM90_MAIZE SC3 protein OS=Zea mays PE=2 SV=1 57 4e-07
tr|A9PAD5|A9PAD5_POPTR Putative uncharacterized protein OS=Popul... 57 5e-07
tr|A9NLD9|A9NLD9_PICSI Putative uncharacterized protein OS=Picea... 57 5e-07
tr|B8AL64|B8AL64_ORYSI Putative uncharacterized protein OS=Oryza... 56 8e-07
tr|A9TLD7|A9TLD7_PHYPA Predicted protein OS=Physcomitrella paten... 56 1e-06
tr|B8AZR2|B8AZR2_ORYSI Putative uncharacterized protein OS=Oryza... 55 2e-06
tr|B7EVJ1|B7EVJ1_ORYSJ cDNA clone:001-022-H12, full insert seque... 55 2e-06
tr|B6T3X4|B6T3X4_MAIZE SC3 protein OS=Zea mays PE=2 SV=1 55 2e-06
tr|A7PBX6|A7PBX6_VITVI Chromosome chr2 scaffold_11, whole genome... 55 2e-06
tr|B6TBK8|B6TBK8_MAIZE SC3 protein OS=Zea mays PE=2 SV=1 54 3e-06
tr|A9RVB1|A9RVB1_PHYPA Predicted protein OS=Physcomitrella paten... 54 3e-06
tr|B8AAF2|B8AAF2_ORYSI Putative uncharacterized protein OS=Oryza... 53 7e-06
tr|B7EEY2|B7EEY2_ORYSJ cDNA clone:J013157H06, full insert sequen... 53 7e-06
tr|A2ZYF4|A2ZYF4_ORYSJ Putative uncharacterized protein OS=Oryza... 53 7e-06
tr|B8ATK5|B8ATK5_ORYSI Putative uncharacterized protein OS=Oryza... 52 1e-05
tr|B7E314|B7E314_ORYSJ cDNA clone:001-018-E05, full insert seque... 52 1e-05

>tr|A9TRH7|A9TRH7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_197515 PE=4 SV=1
Length = 305

Score = 63.9 bits (154), Expect = 4e-09
Identities = 29/41 (70%), Positives = 34/41 (82%)
Frame = -1

Query: 331 FSDSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
F ++ LV IFY+VG V F LEALLS+WVLK+VY YFRGSGK
Sbjct: 248 FGENALVAIFYVVGFVLFTLEALLSIWVLKEVYDYFRGSGK 288


>tr|B6TQ03|B6TQ03_MAIZE SC3 protein OS=Zea mays PE=2 SV=1
Length = 313

Score = 61.2 bits (147), Expect = 2e-08
Identities = 26/39 (66%), Positives = 33/39 (84%)
Frame = -1

Query: 325 DSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
DS +VGIFY +G F LEALLS+WV+++VY+YFRGSGK
Sbjct: 258 DSVIVGIFYFIGFALFCLEALLSVWVIQRVYLYFRGSGK 296


>tr|B7FIP0|B7FIP0_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 311

Score = 60.8 bits (146), Expect = 3e-08
Identities = 26/39 (66%), Positives = 33/39 (84%)
Frame = -1

Query: 325 DSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
+STL+GIFY +G F LE L+S+WV++QVYMYFRGSGK
Sbjct: 256 NSTLIGIFYFIGFGFFCLETLISIWVIQQVYMYFRGSGK 294


>tr|B3TLU6|B3TLU6_ELAGV Secretory carrier membrane protein OS=Elaeis
guineensis var. tenera PE=2 SV=1
Length = 310

Score = 60.8 bits (146), Expect = 3e-08
Identities = 27/40 (67%), Positives = 33/40 (82%)
Frame = -1

Query: 328 SDSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
SD LVGIFY +G F +E+LLS+WV++QVYMYFRGSGK
Sbjct: 254 SDHVLVGIFYFIGFGLFCVESLLSVWVIQQVYMYFRGSGK 293


>tr|A9S5T7|A9S5T7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_181545 PE=4 SV=1
Length = 306

Score = 60.8 bits (146), Expect = 3e-08
Identities = 27/41 (65%), Positives = 33/41 (80%)
Frame = -1

Query: 331 FSDSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
F D+ LV IFY++G V F LE LLS+WV+K+VY YFRGSGK
Sbjct: 249 FGDNVLVAIFYVLGCVFFSLELLLSIWVIKEVYDYFRGSGK 289


>tr|B6U711|B6U711_MAIZE SC3 protein OS=Zea mays PE=2 SV=1
Length = 316

Score = 60.5 bits (145), Expect = 4e-08
Identities = 25/39 (64%), Positives = 33/39 (84%)
Frame = -1

Query: 325 DSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
DS +VGIFY +G F LE+LLS+WV+++VY+YFRGSGK
Sbjct: 261 DSVIVGIFYFIGFALFCLESLLSMWVIQRVYLYFRGSGK 299


>tr|B7X6S6|B7X6S6_TOBAC Secretory carrier-associated membrane
protein 2 OS=Nicotiana tabacum GN=NtSCAMP2 PE=2 SV=1
Length = 271

Score = 60.1 bits (144), Expect = 6e-08
Identities = 27/38 (71%), Positives = 32/38 (84%)
Frame = -1

Query: 331 FSDSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRG 218
FSD LVGIFY++G F LEALLSLWVL++VYM+FRG
Sbjct: 232 FSDHVLVGIFYLIGFAFFCLEALLSLWVLQKVYMFFRG 269


>tr|B6TAX3|B6TAX3_MAIZE SC3 protein OS=Zea mays PE=2 SV=1
Length = 305

Score = 60.1 bits (144), Expect = 6e-08
Identities = 28/40 (70%), Positives = 33/40 (82%)
Frame = -1

Query: 328 SDSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
S + LVGIFY VG F LE+LLS+WV++QVYMYFRGSGK
Sbjct: 249 SVNALVGIFYFVGFGLFCLESLLSIWVIQQVYMYFRGSGK 288


>tr|B4FNI8|B4FNI8_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 305

Score = 60.1 bits (144), Expect = 6e-08
Identities = 28/40 (70%), Positives = 33/40 (82%)
Frame = -1

Query: 328 SDSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGSGK 209
S + LVGIFY VG F LE+LLS+WV++QVYMYFRGSGK
Sbjct: 249 SVNALVGIFYFVGFGLFCLESLLSIWVIQQVYMYFRGSGK 288


>tr|A9PF06|A9PF06_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 270

Score = 60.1 bits (144), Expect = 6e-08
Identities = 27/39 (69%), Positives = 33/39 (84%)
Frame = -1

Query: 331 FSDSTLVGIFYIVGTVCFVLEALLSLWVLKQVYMYFRGS 215
FSD LVGIFY+VG F LE+LLSLWVL+++YMYFRG+
Sbjct: 231 FSDHVLVGIFYLVGFGLFCLESLLSLWVLQKIYMYFRGN 269