BP912096
Clone id YMU001_000015_A11
Library
Length 475
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000015_A11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ACAGACTTGAACTCATCCTGGTGTGCTCCACCATAAACACAAATGCTTAACTTTGCCCTT
TCTGGGGCATTAGCTTTAATATACTTTGTATAAAAGTCCAGCAAGTCTTGTTTGCAGACC
TTTCTTAGAGCACCAACCTCATCCTTCTGACTGCTGAACTTCTGTGTACCACAGTCAATT
ACATTCCAGAAAAATCCTGTGTCTTCGGCTAAGTTCTTGTGTTTCTCGAGCTTTATTCCA
ACCAAAGCATGGACATTACTCTTAAATTCTTCATCCGTCAGTTGGCTTAAATTAGTGTGG
ACCAAGCTCTAAAATTCTTCAACTCTTGCATCCAAATCCTTTGGATCCTTCAAAGCTGAT
TGAATAATGAACTGTGCTCCTCTCACACCAGAGTTATCTCTGTTTGCTAAAACCACAATA
TAACCAAGTTGCTGAACTGTTCGCAACTGATAAAATGCTTCTTGCTTTGTGCTTA
■■Homology search results ■■ -
sp_hit_id P14735
Definition sp|P14735|IDE_HUMAN Insulin-degrading enzyme OS=Homo sapiens
Align length 143
Score (bit) 91.3
E-value 2.0e-18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912096|Adiantum capillus-veneris mRNA, clone:
YMU001_000015_A11.
(475 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P14735|IDE_HUMAN Insulin-degrading enzyme OS=Homo sapiens GN=... 91 2e-18
sp|Q24K02|IDE_BOVIN Insulin-degrading enzyme OS=Bos taurus GN=ID... 91 3e-18
sp|P35559|IDE_RAT Insulin-degrading enzyme OS=Rattus norvegicus ... 87 3e-17
sp|Q9JHR7|IDE_MOUSE Insulin-degrading enzyme OS=Mus musculus GN=... 87 4e-17
sp|P22817|IDE_DROME Insulin-degrading enzyme OS=Drosophila melan... 80 6e-15
sp|Q06010|STE23_YEAST A-factor-processing enzyme OS=Saccharomyce... 69 8e-12
sp|O14077|MU138_SCHPO Putative zinc protease mug138 OS=Schizosac... 63 6e-10
sp|O43847|NRDC_HUMAN Nardilysin OS=Homo sapiens GN=NRD1 PE=1 SV=2 62 1e-09
sp|Q5R4H6|NRDC_PONAB Nardilysin OS=Pongo abelii GN=NRD1 PE=2 SV=1 62 2e-09
sp|P47245|NRDC_RAT Nardilysin OS=Rattus norvegicus GN=Nrd1 PE=2 ... 61 2e-09
sp|Q8BHG1|NRDC_MOUSE Nardilysin OS=Mus musculus GN=Nrd1 PE=2 SV=1 61 2e-09
sp|Q10040|YQA4_CAEEL Putative zinc protease C28F5.4 OS=Caenorhab... 51 2e-06
sp|Q8CVS2|PTRA_ECOL6 Protease 3 OS=Escherichia coli O6 GN=ptrA P... 51 3e-06
sp|Q83QC3|PTRA_SHIFL Protease 3 OS=Shigella flexneri GN=ptrA PE=... 50 7e-06
sp|P05458|PTRA_ECOLI Protease 3 OS=Escherichia coli (strain K12)... 50 7e-06
sp|Q8X6M8|PTRA_ECO57 Protease 3 OS=Escherichia coli O157:H7 GN=p... 48 2e-05
sp|Q8ZMB5|PTRA_SALTY Protease 3 OS=Salmonella typhimurium GN=ptr... 48 3e-05
sp|Q8Z418|PTRA_SALTI Protease 3 OS=Salmonella typhi GN=ptrA PE=3... 48 3e-05
sp|Q54JQ2|IDE_DICDI Insulin-degrading enzyme homolog OS=Dictyost... 42 0.001
sp|A0Q860|RIMM_FRATN Ribosome maturation factor rimM OS=Francise... 35 0.22
sp|A4IWA6|RIMM_FRATW Ribosome maturation factor rimM OS=Francise... 33 0.84
sp|Q0BKD2|RIMM_FRATO Ribosome maturation factor rimM OS=Francise... 33 0.84
sp|Q2A1N4|RIMM_FRATH Ribosome maturation factor rimM OS=Francise... 33 0.84
sp|A7NEB2|RIMM_FRATF Ribosome maturation factor rimM OS=Francise... 33 0.84
sp|Q5NIC5|RIMM_FRATT Ribosome maturation factor rimM OS=Francise... 32 1.9
sp|Q14JS8|RIMM_FRAT1 Ribosome maturation factor rimM OS=Francise... 32 1.9
sp|P87126|CWC2_SCHPO Pre-mRNA-splicing factor cwc2 OS=Schizosacc... 32 1.9
sp|A8WXX7|FAM50_CAEBR Protein FAM50 homolog OS=Caenorhabditis br... 30 4.2
sp|Q869S7|SUCB2_DICDI Succinyl-CoA ligase [GDP-forming] subunit ... 30 5.4
sp|Q57781|Y335_METJA Uncharacterized protein MJ0335 OS=Methanoca... 30 7.1

>sp|P14735|IDE_HUMAN Insulin-degrading enzyme OS=Homo sapiens GN=IDE
PE=1 SV=4
Length = 1019

Score = 91.3 bits (225), Expect = 2e-18
Identities = 50/143 (34%), Positives = 81/143 (56%)
Frame = -3

Query: 464 QEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNLS 285
+ F LRT +QLGYIV R +G++G +FIIQS K P L++RVE F + ++
Sbjct: 817 EPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQSE-KPPHYLESRVEAFLITMEKSIE 875

Query: 284 QLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQD 105
+T+E F+ ++ AL +L+K K L+ + +W I F EV L+ + K+D
Sbjct: 876 DMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKTLTKED 935

Query: 104 LLDFYTKYIKANAPERAKLSICV 36
++ FY + + +AP R K+S+ V
Sbjct: 936 IIKFYKEMLAVDAPRRHKVSVHV 958


>sp|Q24K02|IDE_BOVIN Insulin-degrading enzyme OS=Bos taurus GN=IDE
PE=2 SV=1
Length = 1019

Score = 90.5 bits (223), Expect = 3e-18
Identities = 50/143 (34%), Positives = 81/143 (56%)
Frame = -3

Query: 464 QEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNLS 285
+ F LRT +QLGYIV R +G++G +FIIQS K P L++RVE F + ++
Sbjct: 817 EPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQSE-KPPHYLESRVEAFLITMEKSIE 875

Query: 284 QLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQD 105
+T+E F+ ++ AL +L+K K L+ + +W I F EV L+ + K+D
Sbjct: 876 DMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKTLTKED 935

Query: 104 LLDFYTKYIKANAPERAKLSICV 36
++ FY + + +AP R K+S+ V
Sbjct: 936 IIKFYKEMLAVDAPRRHKVSVHV 958


>sp|P35559|IDE_RAT Insulin-degrading enzyme OS=Rattus norvegicus
GN=Ide PE=1 SV=1
Length = 1019

Score = 87.4 bits (215), Expect = 3e-17
Identities = 49/143 (34%), Positives = 79/143 (55%)
Frame = -3

Query: 464 QEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNLS 285
+ F LRT +QLGYIV R +G++G +FIIQS K P L++RVE F + +
Sbjct: 817 EPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQSE-KPPHYLESRVEAFLITMEKAIE 875

Query: 284 QLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQD 105
+T+E F+ ++ AL +L+K K L+ + +W I + EV L+ + K D
Sbjct: 876 DMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNYDRDNIEVAYLKTLSKDD 935

Query: 104 LLDFYTKYIKANAPERAKLSICV 36
++ FY + + +AP R K+S+ V
Sbjct: 936 IIKFYKEMLAVDAPRRHKVSVHV 958


>sp|Q9JHR7|IDE_MOUSE Insulin-degrading enzyme OS=Mus musculus GN=Ide
PE=2 SV=1
Length = 1019

Score = 87.0 bits (214), Expect = 4e-17
Identities = 49/143 (34%), Positives = 79/143 (55%)
Frame = -3

Query: 464 QEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNLS 285
+ F LRT +QLGYIV R +G++G +FIIQS K P L++RVE F + +
Sbjct: 817 EPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQSE-KPPHYLESRVEAFLITMEKAIE 875

Query: 284 QLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQD 105
+T+E F+ ++ AL +L+K K L+ + +W I + EV L+ + K D
Sbjct: 876 DMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNYDRDNIEVAYLKTLTKDD 935

Query: 104 LLDFYTKYIKANAPERAKLSICV 36
++ FY + + +AP R K+S+ V
Sbjct: 936 IIRFYQEMLAVDAPRRHKVSVHV 958


>sp|P22817|IDE_DROME Insulin-degrading enzyme OS=Drosophila
melanogaster GN=Ide PE=1 SV=4
Length = 990

Score = 79.7 bits (195), Expect = 6e-15
Identities = 48/135 (35%), Positives = 72/135 (53%)
Frame = -3

Query: 446 LRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNLSQLTDEE 267
LRT +QLGYIV R +G G + I+QSA K P ++ R+E F + + +E
Sbjct: 797 LRTKEQLGYIVFSGVRKVNGANGIRIIVQSA-KHPSYVEDRIENFLQTYLQVIEDMPLDE 855

Query: 266 FKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQDLLDFYT 87
F+ + AL KLEK K + + F+ I T F ++ EV LRK+ K D +D++
Sbjct: 856 FERHKEALAVKKLEKPKTIFQQFSQFYGEIAMQTYHFEREEAEVAILRKISKADFVDYFK 915

Query: 86 KYIKANAPERAKLSI 42
K+I + ER LS+
Sbjct: 916 KFIAKDGEERRVLSV 930


>sp|Q06010|STE23_YEAST A-factor-processing enzyme OS=Saccharomyces
cerevisiae GN=STE23 PE=1 SV=2
Length = 1027

Score = 69.3 bits (168), Expect = 8e-12
Identities = 39/129 (30%), Positives = 67/129 (51%)
Frame = -3

Query: 464 QEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNLS 285
+ F LRT +QLGY+V ++ +N G + +IQS P L+ R+ F L
Sbjct: 826 EPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQSEHTTPY-LEWRINNFYETFGQVLR 884

Query: 284 QLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQD 105
+ +E+F+ + AL L+K KN+AE++ + I G F+ ++ + + + KQ
Sbjct: 885 DMPEEDFEKHKEALCNSLLQKFKNMAEESARYTAAIYLGDYNFTHRQKKAKLVANITKQQ 944

Query: 104 LLDFYTKYI 78
++DFY YI
Sbjct: 945 MIDFYENYI 953


>sp|O14077|MU138_SCHPO Putative zinc protease mug138
OS=Schizosaccharomyces pombe GN=mug138 PE=1 SV=1
Length = 969

Score = 63.2 bits (152), Expect = 6e-10
Identities = 39/152 (25%), Positives = 68/152 (44%)
Frame = -3

Query: 467 KQEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNL 288
K+ F LRT +QLGYIV R + +QS + L++R+ +
Sbjct: 777 KEPTFSILRTKEQLGYIVFTLVRQVTPFINLNIFVQSE-RSSTYLESRIRALLDQFKSEF 835

Query: 287 SQLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQ 108
+++DE+F + +L+ LEKH NL E++ +W I G F+ + + + + K
Sbjct: 836 LEMSDEDFSKHKSSLINFMLEKHTNLKEESSMYWLRICDGFYDFTRLEKQAEIVSTITKD 895

Query: 107 DLLDFYTKYIKANAPERAKLSICVYGGAHQDE 12
+ F+ I K+S+ V +DE
Sbjct: 896 EFYSFFINNIHYEGENTKKISVHVVSQRCEDE 927


>sp|O43847|NRDC_HUMAN Nardilysin OS=Homo sapiens GN=NRD1 PE=1 SV=2
Length = 1150

Score = 62.0 bits (149), Expect = 1e-09
Identities = 43/148 (29%), Positives = 71/148 (47%), Gaps = 2/148 (1%)
Frame = -3

Query: 467 KQEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFII--QSALKDPKDLDARVEEF*SLVHT 294
++ F LRT Q LGY V R+ SG+ G + Q+ + + +D ++EEF S
Sbjct: 944 EEPCFDFLRTKQTLGYHVYPTCRNTSGILGFSVTVGTQATKYNSEVVDKKIEEFLSSFEE 1003

Query: 293 NLSQLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVC 114
+ LT+E F + V AL+ +K + +L E+ WN + F E+ AL+
Sbjct: 1004 KIENLTEEAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFS 1063

Query: 113 KQDLLDFYTKYIKANAPERAKLSICVYG 30
K DL++++ + P LS+ V G
Sbjct: 1064 KSDLVNWFKAH---RGPGSKMLSVHVVG 1088


>sp|Q5R4H6|NRDC_PONAB Nardilysin OS=Pongo abelii GN=NRD1 PE=2 SV=1
Length = 1152

Score = 61.6 bits (148), Expect = 2e-09
Identities = 43/148 (29%), Positives = 70/148 (47%), Gaps = 2/148 (1%)
Frame = -3

Query: 467 KQEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFII--QSALKDPKDLDARVEEF*SLVHT 294
++ F LRT Q LGY V R SG+ G + Q+ + + +D ++EEF S
Sbjct: 946 EEPCFDFLRTKQTLGYHVYPTCRSTSGILGFSVTVGTQATKYNSEVVDKKIEEFLSSFEE 1005

Query: 293 NLSQLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVC 114
+ LT+E F + V AL+ +K + +L E+ WN + F E+ AL+
Sbjct: 1006 KIENLTEEAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFS 1065

Query: 113 KQDLLDFYTKYIKANAPERAKLSICVYG 30
K DL++++ + P LS+ V G
Sbjct: 1066 KSDLVNWFKAH---RGPGSKMLSVHVVG 1090


>sp|P47245|NRDC_RAT Nardilysin OS=Rattus norvegicus GN=Nrd1 PE=2 SV=1
Length = 1161

Score = 61.2 bits (147), Expect = 2e-09
Identities = 42/148 (28%), Positives = 70/148 (47%), Gaps = 2/148 (1%)
Frame = -3

Query: 467 KQEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFII--QSALKDPKDLDARVEEF*SLVHT 294
++ F LRT Q LGY V R+ SG+ G + Q+ + + +D ++EEF S
Sbjct: 956 EEPCFDFLRTKQTLGYHVYPTCRNTSGILGFSVTVGTQATKYNSETVDKKIEEFLSSFEE 1015

Query: 293 NLSQLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVC 114
+ LT++ F + V AL+ +K + +L E+ WN + F E+ AL+
Sbjct: 1016 KIENLTEDAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFS 1075

Query: 113 KQDLLDFYTKYIKANAPERAKLSICVYG 30
K DL+ ++ + P LS+ V G
Sbjct: 1076 KSDLVSWFKAH---RGPGSKMLSVHVVG 1100


tr_hit_id Q7XIH3
Definition tr|Q7XIH3|Q7XIH3_ORYSJ Putative insulin degrading enzyme OS=Oryza sativa subsp. japonica
Align length 154
Score (bit) 174.0
E-value 3.0e-42
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912096|Adiantum capillus-veneris mRNA, clone:
YMU001_000015_A11.
(475 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q7XIH3|Q7XIH3_ORYSJ Putative insulin degrading enzyme OS=Oryz... 174 3e-42
tr|B8B7I6|B8B7I6_ORYSI Putative uncharacterized protein OS=Oryza... 174 3e-42
tr|A3BLC0|A3BLC0_ORYSJ Putative uncharacterized protein OS=Oryza... 174 3e-42
tr|Q7XIH2|Q7XIH2_ORYSJ Os07g0570300 protein OS=Oryza sativa subs... 170 3e-41
tr|B8B7I7|B8B7I7_ORYSI Putative uncharacterized protein OS=Oryza... 170 3e-41
tr|A3BLC1|A3BLC1_ORYSJ Putative uncharacterized protein OS=Oryza... 170 3e-41
tr|A7PWF5|A7PWF5_VITVI Chromosome chr8 scaffold_34, whole genome... 169 6e-41
tr|Q0D5B7|Q0D5B7_ORYSJ Os07g0570100 protein OS=Oryza sativa subs... 167 2e-40
tr|Q93YG9|Q93YG9_SOLLC Insulin degrading enzyme OS=Solanum lycop... 162 8e-39
tr|A9S614|A9S614_PHYPA Predicted protein OS=Physcomitrella paten... 162 1e-38
tr|Q0D5B4|Q0D5B4_ORYSJ Os07g0570500 protein OS=Oryza sativa subs... 161 1e-38
tr|A9SVZ0|A9SVZ0_PHYPA Predicted protein OS=Physcomitrella paten... 160 3e-38
tr|Q0WVU4|Q0WVU4_ARATH Putative zinc protease OS=Arabidopsis tha... 158 1e-37
tr|O22941|O22941_ARATH Putative zinc protease OS=Arabidopsis tha... 158 1e-37
tr|A7PWF4|A7PWF4_VITVI Chromosome chr8 scaffold_34, whole genome... 156 6e-37
tr|Q9SCM5|Q9SCM5_ARATH Protease-like protein OS=Arabidopsis thal... 150 4e-35
tr|B6EUA3|B6EUA3_ARATH Putative uncharacterized protein At3g5747... 150 4e-35
tr|B8AAE3|B8AAE3_ORYSI Putative uncharacterized protein OS=Oryza... 145 1e-33
tr|Q5ZCF2|Q5ZCF2_ORYSJ Putative insulin degrading enzyme (Os01g0... 145 1e-33
tr|Q5ZCF0|Q5ZCF0_ORYSJ Putative insulin degrading enzyme OS=Oryz... 142 1e-32
tr|Q0JIT3|Q0JIT3_ORYSJ Os01g0779100 protein OS=Oryza sativa subs... 142 1e-32
tr|A2ZYE9|A2ZYE9_ORYSJ Putative uncharacterized protein OS=Oryza... 142 1e-32
tr|A2ZYE7|A2ZYE7_ORYSJ Putative uncharacterized protein OS=Oryza... 135 8e-31
tr|A9TAJ3|A9TAJ3_PHYPA Predicted protein OS=Physcomitrella paten... 135 1e-30
tr|A9SC02|A9SC02_PHYPA Predicted protein OS=Physcomitrella paten... 131 1e-29
tr|B8AAE8|B8AAE8_ORYSI Putative uncharacterized protein OS=Oryza... 130 3e-29
tr|A7SEX7|A7SEX7_NEMVE Predicted protein OS=Nematostella vectens... 98 2e-19
tr|A8PIJ2|A8PIJ2_BRUMA Insulin-degrading enzyme, putative OS=Bru... 97 3e-19
tr|B7GEM5|B7GEM5_PHATR Predicted protein OS=Phaeodactylum tricor... 97 5e-19
tr|B2WLL5|B2WLL5_PYRTR Insulin-degrading enzyme OS=Pyrenophora t... 96 9e-19

>tr|Q7XIH3|Q7XIH3_ORYSJ Putative insulin degrading enzyme OS=Oryza
sativa subsp. japonica GN=OJ1019_E02.24 PE=3 SV=1
Length = 998

Score = 174 bits (440), Expect = 3e-42
Identities = 84/154 (54%), Positives = 115/154 (74%)
Frame = -3

Query: 467 KQEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNL 288
KQ AF+QLR+V+QLGYI VL R++SGVRG QFIIQS +KDP +LD RVE F ++ L
Sbjct: 806 KQPAFHQLRSVEQLGYITVLTQRNDSGVRGLQFIIQSTVKDPSNLDDRVEAFLNMFEGTL 865

Query: 287 SQLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQ 108
Q+ DEEFKSNV+AL+ +KLEK+KN+ E++ FFW I GT KF ++ EV ALR + K+
Sbjct: 866 YQMPDEEFKSNVNALIDMKLEKYKNIREESAFFWKEISEGTLKFDRKEAEVAALRDLNKE 925

Query: 107 DLLDFYTKYIKANAPERAKLSICVYGGAHQDEFK 6
+L++F+ ++K NAP++ LSI VYGG H E++
Sbjct: 926 ELIEFFNNHVKVNAPQKKILSIQVYGGLHSSEYE 959


>tr|B8B7I6|B8B7I6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_26542 PE=4 SV=1
Length = 998

Score = 174 bits (440), Expect = 3e-42
Identities = 84/154 (54%), Positives = 115/154 (74%)
Frame = -3

Query: 467 KQEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNL 288
KQ AF+QLR+V+QLGYI VL R++SGVRG QFIIQS +KDP +LD RVE F ++ L
Sbjct: 806 KQPAFHQLRSVEQLGYITVLTQRNDSGVRGLQFIIQSTVKDPSNLDDRVEAFLNMFEGTL 865

Query: 287 SQLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQ 108
Q+ DEEFKSNV+AL+ +KLEK+KN+ E++ FFW I GT KF ++ EV ALR + K+
Sbjct: 866 YQMPDEEFKSNVNALIDMKLEKYKNIREESAFFWKEISEGTLKFDRKEAEVAALRDLNKE 925

Query: 107 DLLDFYTKYIKANAPERAKLSICVYGGAHQDEFK 6
+L++F+ ++K NAP++ LSI VYGG H E++
Sbjct: 926 ELIEFFNNHVKVNAPQKKILSIQVYGGLHSSEYE 959


>tr|A3BLC0|A3BLC0_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_023842 PE=3 SV=1
Length = 1015

Score = 174 bits (440), Expect = 3e-42
Identities = 84/154 (54%), Positives = 115/154 (74%)
Frame = -3

Query: 467 KQEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNL 288
KQ AF+QLR+V+QLGYI VL R++SGVRG QFIIQS +KDP +LD RVE F ++ L
Sbjct: 823 KQPAFHQLRSVEQLGYITVLTQRNDSGVRGLQFIIQSTVKDPSNLDDRVEAFLNMFEGTL 882

Query: 287 SQLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQ 108
Q+ DEEFKSNV+AL+ +KLEK+KN+ E++ FFW I GT KF ++ EV ALR + K+
Sbjct: 883 YQMPDEEFKSNVNALIDMKLEKYKNIREESAFFWKEISEGTLKFDRKEAEVAALRDLNKE 942

Query: 107 DLLDFYTKYIKANAPERAKLSICVYGGAHQDEFK 6
+L++F+ ++K NAP++ LSI VYGG H E++
Sbjct: 943 ELIEFFNNHVKVNAPQKKILSIQVYGGLHSSEYE 976


>tr|Q7XIH2|Q7XIH2_ORYSJ Os07g0570300 protein OS=Oryza sativa subsp.
japonica GN=OJ1019_E02.25 PE=3 SV=1
Length = 988

Score = 170 bits (431), Expect = 3e-41
Identities = 82/154 (53%), Positives = 115/154 (74%)
Frame = -3

Query: 467 KQEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNL 288
KQ AF+QLR+V+QLGYI +L +++SGVRG QFIIQS +KDP +LDARVE F ++ L
Sbjct: 796 KQPAFHQLRSVEQLGYITLLRQKNDSGVRGLQFIIQSTVKDPANLDARVEAFLTMFEGTL 855

Query: 287 SQLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQ 108
Q+ D EFKSNV+AL+ +KLEK+KN+ E++ FFW I GT KF ++ EV ALR + K+
Sbjct: 856 YQMPDTEFKSNVNALIDMKLEKYKNIREESAFFWGEISEGTLKFDRKEVEVAALRDLKKE 915

Query: 107 DLLDFYTKYIKANAPERAKLSICVYGGAHQDEFK 6
+L++F+ ++K NAP++ LSI VYGG H E++
Sbjct: 916 ELIEFFNNHVKVNAPQKKILSIQVYGGLHSSEYE 949


>tr|B8B7I7|B8B7I7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_26543 PE=4 SV=1
Length = 989

Score = 170 bits (431), Expect = 3e-41
Identities = 82/154 (53%), Positives = 115/154 (74%)
Frame = -3

Query: 467 KQEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNL 288
KQ AF+QLR+V+QLGYI +L +++SGVRG QFIIQS +KDP +LDARVE F ++ L
Sbjct: 797 KQPAFHQLRSVEQLGYITLLRQKNDSGVRGLQFIIQSTVKDPANLDARVEAFLTMFEGTL 856

Query: 287 SQLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQ 108
Q+ D EFKSNV+AL+ +KLEK+KN+ E++ FFW I GT KF ++ EV ALR + K+
Sbjct: 857 YQMPDTEFKSNVNALIDMKLEKYKNIREESAFFWGEISEGTLKFDRKEVEVAALRDLKKE 916

Query: 107 DLLDFYTKYIKANAPERAKLSICVYGGAHQDEFK 6
+L++F+ ++K NAP++ LSI VYGG H E++
Sbjct: 917 ELIEFFNNHVKVNAPQKKILSIQVYGGLHSSEYE 950


>tr|A3BLC1|A3BLC1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_023843 PE=3 SV=1
Length = 1961

Score = 170 bits (431), Expect = 3e-41
Identities = 82/154 (53%), Positives = 115/154 (74%)
Frame = -3

Query: 467 KQEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNL 288
KQ AF+QLR+V+QLGYI +L +++SGVRG QFIIQS +KDP +LDARVE F ++ L
Sbjct: 1769 KQPAFHQLRSVEQLGYITLLRQKNDSGVRGLQFIIQSTVKDPANLDARVEAFLTMFEGTL 1828

Query: 287 SQLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQ 108
Q+ D EFKSNV+AL+ +KLEK+KN+ E++ FFW I GT KF ++ EV ALR + K+
Sbjct: 1829 YQMPDTEFKSNVNALIDMKLEKYKNIREESAFFWGEISEGTLKFDRKEVEVAALRDLKKE 1888

Query: 107 DLLDFYTKYIKANAPERAKLSICVYGGAHQDEFK 6
+L++F+ ++K NAP++ LSI VYGG H E++
Sbjct: 1889 ELIEFFNNHVKVNAPQKKILSIQVYGGLHSSEYE 1922



Score = 161 bits (408), Expect = 1e-38
Identities = 80/154 (51%), Positives = 111/154 (72%)
Frame = -3

Query: 467 KQEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNL 288
KQ AF+QLR+V+QLGYI L R++SGVRG QF IQS +KDP +LDARVE F + L
Sbjct: 872 KQPAFHQLRSVEQLGYITWLKQRNDSGVRGLQFTIQSTVKDPANLDARVEAFLKMFEGTL 931

Query: 287 SQLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQ 108
Q+ D EFKS+V+AL+ +KLEK+KN+ E++ FFW I GT KF ++ EV ALR + K+
Sbjct: 932 YQMPDIEFKSDVNALINMKLEKYKNIREESAFFWREISEGTLKFDRKEAEVAALRDLKKE 991

Query: 107 DLLDFYTKYIKANAPERAKLSICVYGGAHQDEFK 6
+L++F+ ++K NAP + LSI VYG H +E++
Sbjct: 992 ELIEFFDNHVKVNAPRKKILSIQVYGRLHTNEYE 1025


>tr|A7PWF5|A7PWF5_VITVI Chromosome chr8 scaffold_34, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00025592001
PE=3 SV=1
Length = 965

Score = 169 bits (428), Expect = 6e-41
Identities = 79/153 (51%), Positives = 115/153 (75%)
Frame = -3

Query: 467 KQEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNL 288
KQ AF+QLR+V+QLGYI VL R++SG+RG QFIIQS +K P +D+RV EF + + L
Sbjct: 773 KQRAFHQLRSVEQLGYITVLMQRNDSGIRGVQFIIQSTVKGPGHIDSRVVEFLKMFESKL 832

Query: 287 SQLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQ 108
++++EFKSNV+AL+ +KLEKHKNL E++GF+W I GT KF ++ EV AL+K+ ++
Sbjct: 833 YAMSEDEFKSNVNALIDMKLEKHKNLREESGFYWREIYDGTLKFDRREAEVAALKKLTQK 892

Query: 107 DLLDFYTKYIKANAPERAKLSICVYGGAHQDEF 9
+L+DF+ ++IK AP++ LS+ VYGG H E+
Sbjct: 893 ELIDFFNEHIKVGAPQKKTLSVRVYGGLHTSEY 925


>tr|Q0D5B7|Q0D5B7_ORYSJ Os07g0570100 protein OS=Oryza sativa subsp.
japonica GN=Os07g0570100 PE=4 SV=1
Length = 562

Score = 167 bits (424), Expect = 2e-40
Identities = 84/159 (52%), Positives = 115/159 (72%), Gaps = 5/159 (3%)
Frame = -3

Query: 467 KQEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALK-----DPKDLDARVEEF*SL 303
KQ AF+QLR+V+QLGYI VL R++SGVRG QFIIQS +K DP +LD RVE F ++
Sbjct: 365 KQPAFHQLRSVEQLGYITVLTQRNDSGVRGLQFIIQSTVKKLLKQDPSNLDDRVEAFLNM 424

Query: 302 VHTNLSQLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALR 123
L Q+ DEEFKSNV+AL+ +KLEK+KN+ E++ FFW I GT KF ++ EV ALR
Sbjct: 425 FEGTLYQMPDEEFKSNVNALIDMKLEKYKNIREESAFFWKEISEGTLKFDRKEAEVAALR 484

Query: 122 KVCKQDLLDFYTKYIKANAPERAKLSICVYGGAHQDEFK 6
+ K++L++F+ ++K NAP++ LSI VYGG H E++
Sbjct: 485 DLNKEELIEFFNNHVKVNAPQKKILSIQVYGGLHSSEYE 523


>tr|Q93YG9|Q93YG9_SOLLC Insulin degrading enzyme OS=Solanum
lycopersicum GN=ide PE=2 SV=1
Length = 971

Score = 162 bits (410), Expect = 8e-39
Identities = 76/155 (49%), Positives = 110/155 (70%)
Frame = -3

Query: 467 KQEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHTNL 288
KQ AF+QLR+V+QLGYI VL R +SGV G QFI+QS KDPK +D RVE F + + L
Sbjct: 779 KQPAFHQLRSVEQLGYITVLMQRSDSGVHGVQFIVQSTAKDPKYIDTRVELFMKMFESKL 838

Query: 287 SQLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVCKQ 108
++T +EFK+NV+AL+ +KLEKHKNL E++ F+W I GT KF + E+ AL+++ ++
Sbjct: 839 YEMTSDEFKNNVNALIDMKLEKHKNLREESRFYWREISDGTLKFDRRDREIVALKQLTQK 898

Query: 107 DLLDFYTKYIKANAPERAKLSICVYGGAHQDEFKS 3
+L DF+ +YIK P + LS+ VYG +H +F++
Sbjct: 899 ELTDFFDEYIKVGVPRKKALSVRVYGSSHSSQFQA 933


>tr|A9S614|A9S614_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_75043 PE=3 SV=1
Length = 982

Score = 162 bits (409), Expect = 1e-38
Identities = 82/157 (52%), Positives = 110/157 (70%)
Frame = -3

Query: 473 STKQEAFYQLRTVQQLGYIVVLANRDNSGVRGAQFIIQSALKDPKDLDARVEEF*SLVHT 294
+ K+E F+QLRTV+QLGY+V L ++++ GVRGA FIIQS KDP+ L+ RVE F
Sbjct: 779 AAKREVFHQLRTVEQLGYVVSLMSKNDFGVRGAHFIIQSTAKDPRGLEERVEVFLEQFEN 838

Query: 293 NLSQLTDEEFKSNVHALVGIKLEKHKNLAEDTGFFWNVIDCGTQKFSSQKDEVGALRKVC 114
+L +++DE+FK NV+ L+ IKLEKHKNL E++ FFW I+ GT F + EV AL+ V
Sbjct: 839 DLQKMSDEDFKKNVYTLIQIKLEKHKNLWEESRFFWGEIEDGTLTFDRPQVEVAALKMVN 898

Query: 113 KQDLLDFYTKYIKANAPERAKLSICVYGGAHQDEFKS 3
K+DLL F + I ++P R KLSI VYGG H EFK+
Sbjct: 899 KEDLLSFVAQNIARDSPNRRKLSIQVYGGQHLAEFKA 935