BP912101
Clone id YMU001_000015_B07
Library
Length 495
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000015_B07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TCACTTCCCTCTCCAGGGCTTGCAGGTGTTGTGTCACCATTTGTCTTTTCTGTCCGAGCT
TGCTTCGAAGGTTTGTCCAGTCCAGAATGACACAGTTGAGTGGCTTACGCCCCCAACTTG
CAAAGGTGGAAAATAGGTTTCATCTCCACTTTCCAAAGGTCCTCTCTCAGCTTCCTCCTT
CATTCCAACGTATTCACTATGCCATTGTGCCCACTGCAGTAGAAGCTCTTACAACTTATG
TTTGCTATCACTTGTAAGGCAATTGTATATAACTTGCACACACGGAGTGCTATCAAAGCA
AGAAGAGCGGGACCGCTTCAAACTTAACCTTCTATCACCAGTGGGTGATACGGGGATATC
ACCAATATCGTCAACACACCCTTTCTCACAAGGTGCATCCTCATGCATCGAAATGTTTTC
ACTGCCAACAAAGCCTATCTGCTTACTCATTCCATCGCTCTCATCAATGTCTCCAATTGA
TAAGAACTCATCATC
■■Homology search results ■■ -
sp_hit_id P39933
Definition sp|P39933|TF3A_YEAST Transcription factor IIIA OS=Saccharomyces cerevisiae
Align length 74
Score (bit) 30.8
E-value 3.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912101|Adiantum capillus-veneris mRNA, clone:
YMU001_000015_B07.
(495 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P39933|TF3A_YEAST Transcription factor IIIA OS=Saccharomyces ... 31 3.5
sp|Q8SV63|Y6G2_ENCCU UPF0329 protein ECU06_1620 OS=Encephalitozo... 30 4.7
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=... 30 6.0
sp|Q9DBY8|NVL_MOUSE Nuclear valosin-containing protein-like OS=M... 30 6.0
sp|Q54QR1|LIMA_DICDI LIM domain-containing protein A OS=Dictyost... 30 6.0
sp|Q499E5|STOX2_MOUSE Storkhead-box protein 2 OS=Mus musculus GN... 30 7.9
sp|Q95K63|STOX2_MACFA Storkhead-box protein 2 OS=Macaca fascicul... 30 7.9
sp|Q9P2F5|STOX2_HUMAN Storkhead-box protein 2 OS=Homo sapiens GN... 30 7.9

>sp|P39933|TF3A_YEAST Transcription factor IIIA OS=Saccharomyces
cerevisiae GN=TFC2 PE=1 SV=1
Length = 429

Score = 30.8 bits (68), Expect = 3.5
Identities = 24/74 (32%), Positives = 32/74 (43%)
Frame = +3

Query: 273 LAHTECYQSKKSGTASNLTFYHQWVIRGYHQYRQHTLSHKVHPHASKCFHCQQSLSAYSF 452
+ HT+ + + G NL FY + Q R H LS VH H C HC + SF
Sbjct: 128 VTHTKSFICPEEGC--NLRFYK------HPQLRAHILS--VHLHKLTCPHCNK-----SF 172

Query: 453 HRSHQCLQLIRTHH 494
R ++ I HH
Sbjct: 173 QRPYRLRNHISKHH 186


>sp|Q8SV63|Y6G2_ENCCU UPF0329 protein ECU06_1620 OS=Encephalitozoon
cuniculi GN=ECU06_1620 PE=3 SV=1
Length = 579

Score = 30.4 bits (67), Expect = 4.7
Identities = 18/75 (24%), Positives = 33/75 (44%), Gaps = 16/75 (21%)
Frame = -1

Query: 180 KEEAERGPLESGDETYFPPLQVGGVS----------------HSTVSFWTGQTFEASSDR 49
+EE+E +E+G+E P +++GG H VS W ++
Sbjct: 346 EEESETEEVEAGEEAEMPSMEIGGARRKTGKKSRGGRKRYKIHKRVSRWR----KSPEKI 401

Query: 48 KDKW*HNTCKPWRGK 4
K++W + + WRG+
Sbjct: 402 KEEWDRESEERWRGR 416


>sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens
GN=ZNF77 PE=2 SV=2
Length = 545

Score = 30.0 bits (66), Expect = 6.0
Identities = 20/67 (29%), Positives = 29/67 (43%)
Frame = +3

Query: 291 YQSKKSGTASNLTFYHQWVIRGYHQYRQHTLSHKVHPHASKCFHCQQSLSAYSFHRSHQC 470
Y+ K+ G A + Y +R+H +H +C HC +S S YS R H
Sbjct: 268 YECKECGKAFSCPSY----------FREHVRTH-TGEKPYECKHCGKSFSCYSSFRDH-- 314

Query: 471 LQLIRTH 491
+RTH
Sbjct: 315 ---VRTH 318


>sp|Q9DBY8|NVL_MOUSE Nuclear valosin-containing protein-like OS=Mus
musculus GN=Nvl PE=2 SV=1
Length = 855

Score = 30.0 bits (66), Expect = 6.0
Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 6/69 (8%)
Frame = +2

Query: 188 TYSLCHCAHCSRSSYNLCLLSLVRQLYITCTHGVLSKQEERDRFKLNL--LSPVGD---- 349
T++ CH AH + L++L R+ + + VL KQ+ + + K + L GD
Sbjct: 455 TFNFCHLAHLTPGFVGADLMALCREAAMCAVNRVLMKQQAQQKKKPEIEGLPSEGDQEER 514

Query: 350 TGISPISST 376
G P S T
Sbjct: 515 LGAEPTSET 523


>sp|Q54QR1|LIMA_DICDI LIM domain-containing protein A
OS=Dictyostelium discoideum GN=limA PE=2 SV=1
Length = 1183

Score = 30.0 bits (66), Expect = 6.0
Identities = 22/49 (44%), Positives = 25/49 (51%), Gaps = 5/49 (10%)
Frame = +3

Query: 363 QYRQHTLSHKVHPH---ASKCFHCQQSLS-AYSF-HRSHQCLQLIRTHH 494
Q +QH+LS VHPH S H Q S S +SF H HQ L HH
Sbjct: 751 QQQQHSLSTVVHPHNATPSHHHHHQHSHSQPHSFDHNQHQHQPLQHHHH 799


>sp|Q499E5|STOX2_MOUSE Storkhead-box protein 2 OS=Mus musculus
GN=Stox2 PE=2 SV=2
Length = 926

Score = 29.6 bits (65), Expect = 7.9
Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 1/65 (1%)
Frame = +2

Query: 143 SPLSKGPLSASSFIPTYS-LCHCAHCSRSSYNLCLLSLVRQLYITCTHGVLSKQEERDRF 319
SP+S P+S S FIP LC S+ + + TC GV + +E R
Sbjct: 59 SPISMSPISQSQFIPLGEILCLAISAMNSARKPVTQEALMEHLTTCFPGVPTPSQEILRH 118

Query: 320 KLNLL 334
LN L
Sbjct: 119 TLNTL 123


>sp|Q95K63|STOX2_MACFA Storkhead-box protein 2 OS=Macaca
fascicularis GN=STOX2 PE=2 SV=1
Length = 926

Score = 29.6 bits (65), Expect = 7.9
Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 1/65 (1%)
Frame = +2

Query: 143 SPLSKGPLSASSFIPTYS-LCHCAHCSRSSYNLCLLSLVRQLYITCTHGVLSKQEERDRF 319
SP+S P+S S FIP LC S+ + + TC GV + +E R
Sbjct: 59 SPISMSPISQSQFIPLGEILCLAISAMNSARKPVTQEALMEHLTTCFPGVPTPSQEILRH 118

Query: 320 KLNLL 334
LN L
Sbjct: 119 TLNTL 123


>sp|Q9P2F5|STOX2_HUMAN Storkhead-box protein 2 OS=Homo sapiens
GN=STOX2 PE=2 SV=2
Length = 926

Score = 29.6 bits (65), Expect = 7.9
Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 1/65 (1%)
Frame = +2

Query: 143 SPLSKGPLSASSFIPTYS-LCHCAHCSRSSYNLCLLSLVRQLYITCTHGVLSKQEERDRF 319
SP+S P+S S FIP LC S+ + + TC GV + +E R
Sbjct: 59 SPISMSPISQSQFIPLGEILCLAISAMNSARKPVTQEALMEHLTTCFPGVPTPSQEILRH 118

Query: 320 KLNLL 334
LN L
Sbjct: 119 TLNTL 123


tr_hit_id A7PAL0
Definition tr|A7PAL0|A7PAL0_VITVI Chromosome chr14 scaffold_9, whole genome shotgun sequence OS=Vitis vinifera
Align length 83
Score (bit) 80.9
E-value 3.0e-14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912101|Adiantum capillus-veneris mRNA, clone:
YMU001_000015_B07.
(495 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PAL0|A7PAL0_VITVI Chromosome chr14 scaffold_9, whole genome... 81 3e-14
tr|Q8LD15|Q8LD15_ARATH Putative uncharacterized protein (At1g672... 72 1e-11
tr|Q3ECG9|Q3ECG9_ARATH Uncharacterized protein At1g67210.2 OS=Ar... 72 1e-11
tr|A0MEE9|A0MEE9_ARATH Putative uncharacterized protein (Fragmen... 72 1e-11
tr|A7P312|A7P312_VITVI Chromosome chr1 scaffold_5, whole genome ... 70 7e-11
tr|B6TAF7|B6TAF7_MAIZE Nucleic acid binding protein OS=Zea mays ... 69 9e-11
tr|B8B2T7|B8B2T7_ORYSI Putative uncharacterized protein OS=Oryza... 63 7e-09
tr|Q651K8|Q651K8_ORYSJ Os06g0495700 protein OS=Oryza sativa subs... 60 6e-08
tr|Q93YW4|Q93YW4_ARATH Putative uncharacterized protein At5g3860... 59 1e-07
tr|B0FU15|B0FU15_ARATH At1g67210 (Fragment) OS=Arabidopsis thali... 57 5e-07
tr|B0FU05|B0FU05_ARATH At1g67210 (Fragment) OS=Arabidopsis thali... 57 5e-07
tr|B0FU19|B0FU19_ARALY At1g67210-like protein (Fragment) OS=Arab... 55 2e-06
tr|B0FU14|B0FU14_ARATH At1g67210 (Fragment) OS=Arabidopsis thali... 52 1e-05
tr|Q61491|Q61491_MOUSE DNA-binding protein OS=Mus musculus GN=Zf... 37 0.39
tr|B5YNG4|B5YNG4_THAPS Predicted protein OS=Thalassiosira pseudo... 34 4.3
tr|A9VLA0|A9VLA0_BACWK VrrB protein OS=Bacillus weihenstephanens... 33 5.6
tr|Q9FYH2|Q9FYH2_ARATH F1N21.3 OS=Arabidopsis thaliana PE=4 SV=1 33 5.7
tr|Q8DHM9|Q8DHM9_THEEB Sterol desaturase family protein OS=Therm... 33 9.5
tr|Q11NG9|Q11NG9_CYTH3 Glycosyltransferase-distantly-related pro... 33 9.5
tr|A3DH99|A3DH99_CLOTH Putative uncharacterized protein OS=Clost... 33 9.5
tr|B4BCU4|B4BCU4_CLOTM Putative uncharacterized protein OS=Clost... 33 9.5

>tr|A7PAL0|A7PAL0_VITVI Chromosome chr14 scaffold_9, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038161001
PE=4 SV=1
Length = 752

Score = 80.9 bits (198), Expect = 3e-14
Identities = 39/83 (46%), Positives = 51/83 (61%)
Frame = -1

Query: 294 DSTPCVQVIYNCLTSDSKHKL*ELLLQWAQWHSEYVGMKEEAERGPLESGDETYFPPLQV 115
+ P V VIYN LT DSK KL ELL QW++WH++YV + +G L+SG++TYFP L V
Sbjct: 321 EQQPSVHVIYNSLTRDSKRKLEELLQQWSEWHAKYVSSSHD-PKGQLDSGEKTYFPALHV 379

Query: 114 GGVSHSTVSFWTGQTFEASSDRK 46
G S VSFW D++
Sbjct: 380 GLNKSSAVSFWVDNQTRKQQDKE 402


>tr|Q8LD15|Q8LD15_ARATH Putative uncharacterized protein (At1g67210)
(Family protein/zinc knuckle) OS=Arabidopsis thaliana
GN=At1g67210 PE=2 SV=1
Length = 405

Score = 72.4 bits (176), Expect = 1e-11
Identities = 39/83 (46%), Positives = 50/83 (60%)
Frame = -1

Query: 294 DSTPCVQVIYNCLTSDSKHKL*ELLLQWAQWHSEYVGMKEEAERGPLESGDETYFPPLQV 115
+ P V V Y LT DSK KL LL QW++W +E + E+ E+ LE+GDETYFP L+V
Sbjct: 77 EQQPSVHVTYKHLTRDSKQKLESLLQQWSEWEAEQNSLSEDQEQ-VLEAGDETYFPALRV 135

Query: 114 GGVSHSTVSFWTGQTFEASSDRK 46
G S+VSFW SS +K
Sbjct: 136 GLQKTSSVSFWFDYQTGHSSSKK 158


>tr|Q3ECG9|Q3ECG9_ARATH Uncharacterized protein At1g67210.2
OS=Arabidopsis thaliana GN=At1g67210 PE=4 SV=1
Length = 403

Score = 72.4 bits (176), Expect = 1e-11
Identities = 39/83 (46%), Positives = 50/83 (60%)
Frame = -1

Query: 294 DSTPCVQVIYNCLTSDSKHKL*ELLLQWAQWHSEYVGMKEEAERGPLESGDETYFPPLQV 115
+ P V V Y LT DSK KL LL QW++W +E + E+ E+ LE+GDETYFP L+V
Sbjct: 77 EQQPSVHVTYKHLTRDSKQKLESLLQQWSEWEAEQNSLSEDQEQ-VLEAGDETYFPALRV 135

Query: 114 GGVSHSTVSFWTGQTFEASSDRK 46
G S+VSFW SS +K
Sbjct: 136 GLQKTSSVSFWFDYQTGHSSSKK 158


>tr|A0MEE9|A0MEE9_ARATH Putative uncharacterized protein (Fragment)
OS=Arabidopsis thaliana PE=2 SV=1
Length = 406

Score = 72.4 bits (176), Expect = 1e-11
Identities = 39/83 (46%), Positives = 50/83 (60%)
Frame = -1

Query: 294 DSTPCVQVIYNCLTSDSKHKL*ELLLQWAQWHSEYVGMKEEAERGPLESGDETYFPPLQV 115
+ P V V Y LT DSK KL LL QW++W +E + E+ E+ LE+GDETYFP L+V
Sbjct: 77 EQQPSVHVTYKHLTRDSKQKLESLLQQWSEWEAEQNSLSEDQEQ-VLEAGDETYFPALRV 135

Query: 114 GGVSHSTVSFWTGQTFEASSDRK 46
G S+VSFW SS +K
Sbjct: 136 GLQKTSSVSFWFDYQTGHSSSKK 158


>tr|A7P312|A7P312_VITVI Chromosome chr1 scaffold_5, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00030264001
PE=4 SV=1
Length = 478

Score = 69.7 bits (169), Expect = 7e-11
Identities = 37/75 (49%), Positives = 46/75 (61%), Gaps = 2/75 (2%)
Frame = -1

Query: 300 CFDSTPCVQVIYNCLTSDSKHKL*ELLLQWAQWHSEYVGMKEEAERGPLESGDETYFPPL 121
C D P V VIYN L+ SK KL ELL W++WH++ ++++ LESGDETYFP L
Sbjct: 14 CDDQQPFVHVIYNSLSRKSKRKLEELLHHWSEWHAQQCSSSKDSDE-VLESGDETYFPAL 72

Query: 120 QV--GGVSHSTVSFW 82
V G S VSFW
Sbjct: 73 HVGLGPEKTSIVSFW 87


>tr|B6TAF7|B6TAF7_MAIZE Nucleic acid binding protein OS=Zea mays
PE=2 SV=1
Length = 527

Score = 69.3 bits (168), Expect = 9e-11
Identities = 33/68 (48%), Positives = 44/68 (64%)
Frame = -1

Query: 285 PCVQVIYNCLTSDSKHKL*ELLLQWAQWHSEYVGMKEEAERGPLESGDETYFPPLQVGGV 106
P V+VIY+ LT +SK KL +L+ QW++W + + EEA LESG+ETY+P L VG
Sbjct: 146 PSVRVIYSDLTRESKRKLMQLMQQWSEWQARRMHHLEEAVEVTLESGEETYYPALHVGSE 205

Query: 105 SHSTVSFW 82
VSFW
Sbjct: 206 KSCAVSFW 213


>tr|B8B2T7|B8B2T7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_23074 PE=4 SV=1
Length = 565

Score = 63.2 bits (152), Expect = 7e-09
Identities = 30/68 (44%), Positives = 40/68 (58%)
Frame = -1

Query: 285 PCVQVIYNCLTSDSKHKL*ELLLQWAQWHSEYVGMKEEAERGPLESGDETYFPPLQVGGV 106
P V+VIY+ LT +SK KL EL+ QW++W + + LE G+ETY+P L VG
Sbjct: 205 PSVRVIYSNLTRESKRKLVELMQQWSEWQTRKQNTLTKTGEEVLECGEETYYPALHVGSE 264

Query: 105 SHSTVSFW 82
VSFW
Sbjct: 265 KSCAVSFW 272


>tr|Q651K8|Q651K8_ORYSJ Os06g0495700 protein OS=Oryza sativa subsp.
japonica GN=B1089G05.15 PE=4 SV=1
Length = 646

Score = 60.1 bits (144), Expect = 6e-08
Identities = 31/69 (44%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
Frame = -1

Query: 285 PCVQVIYNCLTSDSKHKL*ELLLQWAQWHSEYVGMKEEAERGPLESGDETYFPPLQVGGV 106
P V+VIY+ LT +SK KL EL+ QW++W + +A LE G+ETY+P L VG
Sbjct: 269 PSVRVIYSNLTRESKRKLVELMQQWSEWQTRKQNTLTKAGEEVLECGEETYYPALHVGSE 328

Query: 105 SHSTV-SFW 82
V SFW
Sbjct: 329 KSCAVKSFW 337


>tr|Q93YW4|Q93YW4_ARATH Putative uncharacterized protein At5g38600
OS=Arabidopsis thaliana GN=At5g38600 PE=2 SV=1
Length = 532

Score = 58.9 bits (141), Expect = 1e-07
Identities = 30/71 (42%), Positives = 43/71 (60%)
Frame = -1

Query: 294 DSTPCVQVIYNCLTSDSKHKL*ELLLQWAQWHSEYVGMKEEAERGPLESGDETYFPPLQV 115
+ P V V Y LT SK KL LL +W++W +E + ++ E+ ESG+ET FP ++V
Sbjct: 119 EQQPTVHVTYKHLTRASKQKLESLLQKWSEWEAENTSLAQDQEQ-LFESGEETCFPAIRV 177

Query: 114 GGVSHSTVSFW 82
G S+VSFW
Sbjct: 178 GLQKTSSVSFW 188


>tr|B0FU15|B0FU15_ARATH At1g67210 (Fragment) OS=Arabidopsis thaliana
PE=4 SV=1
Length = 88

Score = 57.0 bits (136), Expect = 5e-07
Identities = 28/56 (50%), Positives = 36/56 (64%)
Frame = -1

Query: 294 DSTPCVQVIYNCLTSDSKHKL*ELLLQWAQWHSEYVGMKEEAERGPLESGDETYFP 127
+ P V V Y LT DSK KL LL QW++W +E + E+ E+ LE+GDETYFP
Sbjct: 34 EQQPSVHVTYKHLTRDSKQKLESLLQQWSEWEAEQNSLSEDQEQ-VLEAGDETYFP 88