BP912117
Clone id YMU001_000015_C09
Library
Length 487
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000015_C09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTCTTAATGTAGAGGCAATAAGAGTTTCTTGTGTTTCCAGCACCCCATCTTGTTCTTCGC
ATTTTGTATCCTCCTGTAAAGACTCCTCAGACCTTCCTCCAGGTAGGTTCAAATTCCGTT
GTTCCTCACATTCCTGTCTCTTCTTTGGGATCTGCCTGGTGGGGATTTGTAAAGAAAGAT
CGAGCATGGCTTCATAAACTACAGATATATGGCCACATTCAAGACAATGTACAGTACTAG
AAAGTTGCCCTCCAAAGACACTCTCCACCAATGTAGGAGTCACGTTAGAAGGTTTGCTTG
CCTTTCCATGCTCCTTATCTTCTTCAGCTGCTTCAGAATCGCCACTATGCCCATTTTGCC
CCAGCACTTTACTAAATGAGGTGCTTATAACTTTCCTGTAGTCTCCAGTAAATAAGTTTG
TTGCTGCTCCACTTTCCTCTAAATGTAATCCTTCCAACAAATAACGCAAAAGTTCATGAG
AGTCCTG
■■Homology search results ■■ -
sp_hit_id Q9FPT5
Definition sp|Q9FPT5|UBP1_ARATH Ubiquitin carboxyl-terminal hydrolase 1 OS=Arabidopsis thaliana
Align length 61
Score (bit) 73.9
E-value 4.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912117|Adiantum capillus-veneris mRNA, clone:
YMU001_000015_C09.
(487 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9FPT5|UBP1_ARATH Ubiquitin carboxyl-terminal hydrolase 1 OS=... 74 4e-13
sp|Q8W4N3|UBP2_ARATH Ubiquitin carboxyl-terminal hydrolase 2 OS=... 68 2e-11
sp|Q9Y5T5|UBP16_HUMAN Ubiquitin carboxyl-terminal hydrolase 16 O... 51 3e-06
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=... 47 4e-05
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=... 47 4e-05
sp|Q70EL2|UBP45_HUMAN Ubiquitin carboxyl-terminal hydrolase 45 O... 44 3e-04
sp|Q9SJA1|UBP19_ARATH Ubiquitin carboxyl-terminal hydrolase 19 O... 44 4e-04
sp|Q9FPS9|UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 O... 44 4e-04
sp|Q9MAQ3|UBP11_ARATH Putative ubiquitin carboxyl-terminal hydro... 44 4e-04
sp|Q8K387|UBP45_MOUSE Ubiquitin carboxyl-terminal hydrolase 45 O... 43 7e-04
sp|Q67XW5|UBP18_ARATH Ubiquitin carboxyl-terminal hydrolase 18 O... 43 7e-04
sp|Q8BW70|UBP38_MOUSE Ubiquitin carboxyl-terminal hydrolase 38 O... 42 0.001
sp|Q9FPS4|UBP23_ARATH Ubiquitin carboxyl-terminal hydrolase 23 O... 40 0.004
sp|Q9H9J4|UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 O... 40 0.006
sp|Q8TEY7|UBP33_HUMAN Ubiquitin carboxyl-terminal hydrolase 33 O... 40 0.007
sp|O57429|UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=... 39 0.010
sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 O... 39 0.013
sp|O88623|UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=... 39 0.013
sp|O75604|UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=... 39 0.013
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=... 39 0.016
sp|Q80U87|UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=... 38 0.021
sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=... 38 0.028
sp|Q6P9L4|UBP49_MOUSE Ubiquitin carboxyl-terminal hydrolase 49 O... 38 0.028
sp|Q70CQ1|UBP49_HUMAN Ubiquitin carboxyl-terminal hydrolase 49 O... 38 0.028
sp|Q8NB14|UBP38_HUMAN Ubiquitin carboxyl-terminal hydrolase 38 O... 38 0.028
sp|Q9P275|UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 O... 38 0.028
sp|P0C7I0|U17L8_HUMAN Inactive ubiquitin carboxyl-terminal hydro... 38 0.028
sp|A6NCW7|U17L4_HUMAN Inactive ubiquitin carboxyl-terminal hydro... 38 0.028
sp|A6NCW0|U17L3_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-l... 38 0.028
sp|Q6R6M4|U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-l... 38 0.028

>sp|Q9FPT5|UBP1_ARATH Ubiquitin carboxyl-terminal hydrolase 1
OS=Arabidopsis thaliana GN=UBP1 PE=1 SV=2
Length = 1083

Score = 73.9 bits (180), Expect = 4e-13
Identities = 33/61 (54%), Positives = 44/61 (72%)
Frame = -1

Query: 277 PTLVESVFGGQLSSTVHCLECGHISVVYEAMLDLSLQIPTRQIPKKRQECEEQRNLNLPG 98
PTL++SVFGG++SSTV CLECGH S VYE +DLSL +P+ ++P K+Q+ Q L
Sbjct: 323 PTLIDSVFGGEISSTVSCLECGHFSKVYEPFMDLSLPVPSMKLPPKKQQILSQAKEVLKN 382

Query: 97 G 95
G
Sbjct: 383 G 383


>sp|Q8W4N3|UBP2_ARATH Ubiquitin carboxyl-terminal hydrolase 2
OS=Arabidopsis thaliana GN=UBP2 PE=1 SV=2
Length = 961

Score = 68.2 bits (165), Expect = 2e-11
Identities = 41/97 (42%), Positives = 56/97 (57%), Gaps = 4/97 (4%)
Frame = -1

Query: 340 DSEAAEED---KEHGKASKPSNVTPTLVESVFGGQLSSTVHCLECGHISVVYEAMLDLSL 170
DS + EE K+ G + T TL+ESVFGG+ SS V C+ECGH S VYE LDLSL
Sbjct: 325 DSLSTEESALRKKRGVSDNDEKST-TLIESVFGGETSSIVSCMECGHSSKVYEPFLDLSL 383

Query: 169 QIPTRQI-PKKRQECEEQRNLNLPGGRSEESLQEDTK 62
+P ++ PKK Q + LP R +++ + +K
Sbjct: 384 PVPFKKSPPKKPQPVSRAKKAKLPPKRVPKNVSKVSK 420


>sp|Q9Y5T5|UBP16_HUMAN Ubiquitin carboxyl-terminal hydrolase 16
OS=Homo sapiens GN=USP16 PE=1 SV=1
Length = 823

Score = 50.8 bits (120), Expect = 3e-06
Identities = 32/117 (27%), Positives = 57/117 (48%), Gaps = 1/117 (0%)
Frame = -1

Query: 388 ISTSFSKVLGQNGHSGDSEAAEEDKEHGKASKPSNVTPTLVESVFGGQLSSTVHCLECGH 209
+S K G + D E + K++ K P+ V+ +FGG+L+S + C +C
Sbjct: 319 VSKGILKAFGNSTEKLDEELKNKVKDYEKKKS----MPSFVDRIFGGELTSMIMCDQCRT 374

Query: 208 ISVVYEAMLDLSLQIPTRQIPKKR-QECEEQRNLNLPGGRSEESLQEDTKCEEQDGV 41
+S+V+E+ LDLSL + Q KK + ++ + SEE D+ +E+ +
Sbjct: 375 VSLVHESFLDLSLPVLDDQSGKKSVNDKNLKKTVEDEDQDSEEEKDNDSYIKERSDI 431


>sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus
musculus GN=Usp3 PE=2 SV=1
Length = 520

Score = 47.4 bits (111), Expect = 4e-05
Identities = 38/107 (35%), Positives = 56/107 (52%), Gaps = 3/107 (2%)
Frame = -1

Query: 358 QNGHSGDSEAA--EEDKEHGKASKPS-NVTPTLVESVFGGQLSSTVHCLECGHISVVYEA 188
Q G +G S +A +E+ ++K N T+V ++FGG L + V+CL CG S ++
Sbjct: 277 QGGFNGVSRSAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDP 336

Query: 187 MLDLSLQIPTRQIPKKRQECEEQRNLNLPGGRSEESLQEDTKCEEQD 47
LDLSL IP+ Q KR + +E N P + L+ T EE D
Sbjct: 337 FLDLSLDIPS-QFRSKRSKNQE----NGPVCSLRDCLRSFTDLEELD 378


>sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3
OS=Homo sapiens GN=USP3 PE=1 SV=2
Length = 520

Score = 47.4 bits (111), Expect = 4e-05
Identities = 38/107 (35%), Positives = 56/107 (52%), Gaps = 3/107 (2%)
Frame = -1

Query: 358 QNGHSGDSEAA--EEDKEHGKASKPS-NVTPTLVESVFGGQLSSTVHCLECGHISVVYEA 188
Q G +G S +A +E+ ++K N T+V ++FGG L + V+CL CG S ++
Sbjct: 277 QGGFNGVSRSAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDP 336

Query: 187 MLDLSLQIPTRQIPKKRQECEEQRNLNLPGGRSEESLQEDTKCEEQD 47
LDLSL IP+ Q KR + +E N P + L+ T EE D
Sbjct: 337 FLDLSLDIPS-QFRSKRSKNQE----NGPVCSLRDCLRSFTDLEELD 378


>sp|Q70EL2|UBP45_HUMAN Ubiquitin carboxyl-terminal hydrolase 45
OS=Homo sapiens GN=USP45 PE=1 SV=2
Length = 814

Score = 44.3 bits (103), Expect = 3e-04
Identities = 23/68 (33%), Positives = 38/68 (55%)
Frame = -1

Query: 346 SGDSEAAEEDKEHGKASKPSNVTPTLVESVFGGQLSSTVHCLECGHISVVYEAMLDLSLQ 167
+ D E ++ K +GK N ++ +F G+L+STV C EC +IS V + +D+SL
Sbjct: 328 TADDETRKKVKAYGKEGVKMN----FIDRIFIGELTSTVMCEECANISTVKDPFIDISLP 383

Query: 166 IPTRQIPK 143
I ++ K
Sbjct: 384 IIEERVSK 391


>sp|Q9SJA1|UBP19_ARATH Ubiquitin carboxyl-terminal hydrolase 19
OS=Arabidopsis thaliana GN=UBP19 PE=2 SV=2
Length = 672

Score = 43.9 bits (102), Expect = 4e-04
Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 2/97 (2%)
Frame = -1

Query: 304 KASKPSNVTPTLVESVFGGQLSSTVHCLECGHISVVYEAMLDLSLQIPTRQIPKKRQECE 125
K P TL++ +FGG L S V C C ++S YE M+DL+++I + +EC
Sbjct: 283 KVVPPRAQETTLIQYIFGGLLQSQVQCTACSNVSDQYENMMDLTVEIHGDAV--SLEECL 340

Query: 124 EQRNLNLPGGRSEESLQEDT--KCEEQDGVLETQETL 20
+Q ++E LQ D KC+ D ++ + L
Sbjct: 341 DQFT-------AKEWLQGDNLYKCDRCDDYVKACKRL 370


>sp|Q9FPS9|UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15
OS=Arabidopsis thaliana GN=UBP15 PE=2 SV=2
Length = 924

Score = 43.9 bits (102), Expect = 4e-04
Identities = 20/37 (54%), Positives = 27/37 (72%)
Frame = -1

Query: 274 TLVESVFGGQLSSTVHCLECGHISVVYEAMLDLSLQI 164
TLV+ +FGG+L S V CL C H S YE ++DL+L+I
Sbjct: 557 TLVQHMFGGRLRSKVKCLRCDHESERYENIMDLTLEI 593


>sp|Q9MAQ3|UBP11_ARATH Putative ubiquitin carboxyl-terminal
hydrolase 11 OS=Arabidopsis thaliana GN=UBP11 PE=3 SV=2
Length = 892

Score = 43.9 bits (102), Expect = 4e-04
Identities = 27/82 (32%), Positives = 42/82 (51%)
Frame = -1

Query: 403 DYRKVISTSFSKVLGQNGHSGDSEAAEEDKEHGKASKPSNVTPTLVESVFGGQLSSTVHC 224
D KV + + +G D E AEE ++ KA S ++ VF GQ ST+ C
Sbjct: 406 DLNKVKRKPYIEAKDSDGRP-DDEVAEEKWKYHKARNDS-----VIVDVFQGQYKSTLVC 459

Query: 223 LECGHISVVYEAMLDLSLQIPT 158
+CG IS+ ++ + LSL +P+
Sbjct: 460 PDCGKISITFDPFMYLSLPLPS 481


>sp|Q8K387|UBP45_MOUSE Ubiquitin carboxyl-terminal hydrolase 45
OS=Mus musculus GN=Usp45 PE=2 SV=1
Length = 813

Score = 43.1 bits (100), Expect = 7e-04
Identities = 22/68 (32%), Positives = 38/68 (55%)
Frame = -1

Query: 346 SGDSEAAEEDKEHGKASKPSNVTPTLVESVFGGQLSSTVHCLECGHISVVYEAMLDLSLQ 167
+ D E ++ K +GK N ++ +F G+L+STV C EC +IS + + +D+SL
Sbjct: 329 TADDETRKKVKAYGKEGVKMN----FIDRIFIGELTSTVMCEECANISTMKDPFIDISLP 384

Query: 166 IPTRQIPK 143
I ++ K
Sbjct: 385 IIEERVSK 392


tr_hit_id A7Q739
Definition tr|A7Q739|A7Q739_VITVI Chromosome chr5 scaffold_58, whole genome shotgun sequence OS=Vitis vinifera
Align length 96
Score (bit) 71.2
E-value 2.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912117|Adiantum capillus-veneris mRNA, clone:
YMU001_000015_C09.
(487 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7Q739|A7Q739_VITVI Chromosome chr5 scaffold_58, whole genome... 71 2e-11
tr|A5AXN2|A5AXN2_VITVI Ubiquitin carboxyl-terminal hydrolase OS=... 71 2e-11
tr|A9SUN8|A9SUN8_PHYPA Predicted protein OS=Physcomitrella paten... 69 9e-11
tr|A9U2A7|A9U2A7_PHYPA Predicted protein (Fragment) OS=Physcomit... 68 2e-10
tr|A9RDN7|A9RDN7_PHYPA Predicted protein (Fragment) OS=Physcomit... 66 1e-09
tr|Q0J0M6|Q0J0M6_ORYSJ Ubiquitin carboxyl-terminal hydrolase OS=... 65 2e-09
tr|A2Z2V5|A2Z2V5_ORYSI Ubiquitin carboxyl-terminal hydrolase OS=... 65 2e-09
tr|Q99LG0|Q99LG0_MOUSE Ubiquitin carboxyl-terminal hydrolase OS=... 57 6e-07
tr|Q2KJ09|Q2KJ09_RAT Usp16 protein (Fragment) OS=Rattus norvegic... 56 8e-07
tr|Q6DIK6|Q6DIK6_XENTR Usp16 protein (Fragment) OS=Xenopus tropi... 55 2e-06
tr|Q0VA64|Q0VA64_XENTR Ubiquitin carboxyl-terminal hydrolase OS=... 55 2e-06
tr|Q08DA3|Q08DA3_BOVIN Ubiquitin carboxyl-terminal hydrolase OS=... 54 3e-06
tr|Q4R6X7|Q4R6X7_MACFA Testis cDNA, clone: QtsA-16913, similar t... 54 5e-06
tr|Q4R6G7|Q4R6G7_MACFA Testis cDNA, clone: QtsA-18064, similar t... 54 5e-06
tr|Q4RZ28|Q4RZ28_TETNG Ubiquitin carboxyl-terminal hydrolase (Fr... 53 7e-06
tr|Q4RFR1|Q4RFR1_TETNG Ubiquitin carboxyl-terminal hydrolase (Fr... 53 9e-06
tr|A8HAL1|A8HAL1_DANRE Ubiquitin carboxyl-terminal hydrolase OS=... 52 1e-05
tr|Q6PAW2|Q6PAW2_XENLA Ubiquitin carboxyl-terminal hydrolase OS=... 52 1e-05
tr|Q53HA0|Q53HA0_HUMAN Ubiquitin carboxyl-terminal hydrolase (Fr... 52 2e-05
tr|Q6ZKY0|Q6ZKY0_ORYSJ Ubiquitin-specific protease-like OS=Oryza... 51 3e-05
tr|Q0J4A0|Q0J4A0_ORYSJ Os08g0527100 protein OS=Oryza sativa subs... 51 3e-05
tr|A2YXB3|A2YXB3_ORYSI Putative uncharacterized protein OS=Oryza... 51 3e-05
tr|Q86KB3|Q86KB3_DICDI Ubiquitin carboxyl-terminal hydrolase OS=... 51 3e-05
tr|Q9H3E6|Q9H3E6_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=... 51 3e-05
tr|Q53GP7|Q53GP7_HUMAN Ubiquitin carboxyl-terminal hydrolase (Fr... 51 3e-05
tr|B4DY37|B4DY37_HUMAN cDNA FLJ61461, highly similar to Ubiquiti... 51 3e-05
tr|B4DFV8|B4DFV8_HUMAN cDNA FLJ57270, highly similar to Ubiquiti... 51 3e-05
tr|B3KN13|B3KN13_HUMAN cDNA FLJ13185 fis, clone NT2RP3004209, hi... 51 3e-05
tr|B7PN15|B7PN15_IXOSC Ubiquitin specific protease, putative OS=... 50 4e-05
tr|B6N4E2|B6N4E2_BRAFL Putative uncharacterized protein OS=Branc... 50 4e-05

>tr|A7Q739|A7Q739_VITVI Chromosome chr5 scaffold_58, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00031670001
PE=4 SV=1
Length = 561

Score = 71.2 bits (173), Expect = 2e-11
Identities = 40/96 (41%), Positives = 55/96 (57%), Gaps = 4/96 (4%)
Frame = -1

Query: 343 GDSEAAEEDKEHGKASKPSNVTPTLVESVFGGQLSSTVHCLECGHISVVYEAMLDLSLQI 164
G + A +E G + N PT V+++FGGQ+SSTV C+ECGH S VYE LDLSL +
Sbjct: 342 GARKRANSSQEDGISP---NEAPTFVDTMFGGQISSTVCCVECGHSSTVYEPFLDLSLPV 398

Query: 163 PTRQIP-KKRQECEEQRNLNLP---GGRSEESLQED 68
PT++ P +K Q + LP GR + +D
Sbjct: 399 PTKKPPSRKTQPVSRPKKTKLPPKKAGRVRSKVNKD 434


>tr|A5AXN2|A5AXN2_VITVI Ubiquitin carboxyl-terminal hydrolase
OS=Vitis vinifera GN=VITISV_042515 PE=3 SV=1
Length = 1036

Score = 71.2 bits (173), Expect = 2e-11
Identities = 40/96 (41%), Positives = 55/96 (57%), Gaps = 4/96 (4%)
Frame = -1

Query: 343 GDSEAAEEDKEHGKASKPSNVTPTLVESVFGGQLSSTVHCLECGHISVVYEAMLDLSLQI 164
G + A +E G + N PT V+++FGGQ+SSTV C+ECGH S VYE LDLSL +
Sbjct: 335 GARKRANSSQEDGISP---NEAPTFVDTMFGGQISSTVCCVECGHSSTVYEPFLDLSLPV 391

Query: 163 PTRQIP-KKRQECEEQRNLNLP---GGRSEESLQED 68
PT++ P +K Q + LP GR + +D
Sbjct: 392 PTKKPPSRKTQPVSRPKKTKLPPKKAGRVRSKVNKD 427


>tr|A9SUN8|A9SUN8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_135595 PE=4 SV=1
Length = 334

Score = 69.3 bits (168), Expect = 9e-11
Identities = 35/63 (55%), Positives = 42/63 (66%)
Frame = -1

Query: 340 DSEAAEEDKEHGKASKPSNVTPTLVESVFGGQLSSTVHCLECGHISVVYEAMLDLSLQIP 161
+S + KE+G K + TLVE +FGGQ SSTV C ECGH SVVYE LDLSL IP
Sbjct: 113 ESATDSKVKENGSLDKVPKRSETLVEYMFGGQFSSTVTCCECGHSSVVYEPFLDLSLPIP 172

Query: 160 TRQ 152
++Q
Sbjct: 173 SKQ 175


>tr|A9U2A7|A9U2A7_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_24257 PE=4 SV=1
Length = 324

Score = 68.2 bits (165), Expect = 2e-10
Identities = 37/63 (58%), Positives = 43/63 (68%)
Frame = -1

Query: 340 DSEAAEEDKEHGKASKPSNVTPTLVESVFGGQLSSTVHCLECGHISVVYEAMLDLSLQIP 161
DS + +ED KA K + TLVE +FGGQ SSTV C ECGH SVVYE LDLSL IP
Sbjct: 113 DSNSKDEDGSLEKAPKKPD---TLVEYMFGGQYSSTVTCCECGHSSVVYEPFLDLSLPIP 169

Query: 160 TRQ 152
++Q
Sbjct: 170 SKQ 172


>tr|A9RDN7|A9RDN7_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_24215 PE=4 SV=1
Length = 344

Score = 65.9 bits (159), Expect = 1e-09
Identities = 33/53 (62%), Positives = 34/53 (64%)
Frame = -1

Query: 316 KEHGKASKPSNVTPTLVESVFGGQLSSTVHCLECGHISVVYEAMLDLSLQIPT 158
KE G P V T VE VFGGQ SSTV C CGH SVVYE LDLSL IP+
Sbjct: 124 KEEGSHGNPIKVPVTFVEHVFGGQFSSTVSCCVCGHSSVVYEPFLDLSLPIPS 176


>tr|Q0J0M6|Q0J0M6_ORYSJ Ubiquitin carboxyl-terminal hydrolase
OS=Oryza sativa subsp. japonica GN=Os09g0505100 PE=2
SV=1
Length = 1055

Score = 65.1 bits (157), Expect = 2e-09
Identities = 41/107 (38%), Positives = 62/107 (57%), Gaps = 1/107 (0%)
Frame = -1

Query: 340 DSEAAEEDKEHGKASKPSNVT-PTLVESVFGGQLSSTVHCLECGHISVVYEAMLDLSLQI 164
D EE++ A + S+ T PT+V+S+FGGQLSSTV EC H SV ++ LDLSL +
Sbjct: 317 DGLHTEENEARKLADEASSATIPTIVDSIFGGQLSSTVSSTECTHSSVKHDQFLDLSLPV 376

Query: 163 PTRQIPKKRQECEEQRNLNLPGGRSEESLQEDTKCEEQDGVLETQET 23
P+R+ P K + P R+++SL++ K + G + T+ T
Sbjct: 377 PSRRPPAKSVS-------SPPAKRNKQSLRDRNK-NRRYGKISTRVT 415


>tr|A2Z2V5|A2Z2V5_ORYSI Ubiquitin carboxyl-terminal hydrolase
OS=Oryza sativa subsp. indica GN=OsI_31949 PE=3 SV=1
Length = 1058

Score = 65.1 bits (157), Expect = 2e-09
Identities = 41/107 (38%), Positives = 62/107 (57%), Gaps = 1/107 (0%)
Frame = -1

Query: 340 DSEAAEEDKEHGKASKPSNVT-PTLVESVFGGQLSSTVHCLECGHISVVYEAMLDLSLQI 164
D EE++ A + S+ T PT+V+S+FGGQLSSTV EC H SV ++ LDLSL +
Sbjct: 320 DGLHTEENEARKLADEASSATIPTIVDSIFGGQLSSTVSSTECTHSSVKHDQFLDLSLPV 379

Query: 163 PTRQIPKKRQECEEQRNLNLPGGRSEESLQEDTKCEEQDGVLETQET 23
P+R+ P K + P R+++SL++ K + G + T+ T
Sbjct: 380 PSRRPPAKSVS-------SPPAKRNKQSLRDRNK-NRRYGKISTRVT 418


>tr|Q99LG0|Q99LG0_MOUSE Ubiquitin carboxyl-terminal hydrolase OS=Mus
musculus GN=Usp16 PE=2 SV=1
Length = 825

Score = 56.6 bits (135), Expect = 6e-07
Identities = 36/127 (28%), Positives = 65/127 (51%)
Frame = -1

Query: 388 ISTSFSKVLGQNGHSGDSEAAEEDKEHGKASKPSNVTPTLVESVFGGQLSSTVHCLECGH 209
+S K G + D E + K++ K P+ V+ +FGG+L+ST+ C EC
Sbjct: 318 VSKGILKAFGNSTEKLDEEVKNKVKDYEK----KKAIPSFVDRIFGGELTSTIMCDECRT 373

Query: 208 ISVVYEAMLDLSLQIPTRQIPKKRQECEEQRNLNLPGGRSEESLQEDTKCEEQDGVLETQ 29
+S+V+E+ LDLSL + Q KK +N+ + + E +D++ E+ D ++++
Sbjct: 374 VSLVHESFLDLSLPVLDDQSGKK---SINDKNVKM----TMEEEDKDSEEEKDDSYMKSR 426

Query: 28 ETLIAST 8
L + T
Sbjct: 427 SDLPSGT 433


>tr|Q2KJ09|Q2KJ09_RAT Usp16 protein (Fragment) OS=Rattus norvegicus
GN=Usp16 PE=2 SV=1
Length = 664

Score = 56.2 bits (134), Expect = 8e-07
Identities = 34/127 (26%), Positives = 64/127 (50%)
Frame = -1

Query: 388 ISTSFSKVLGQNGHSGDSEAAEEDKEHGKASKPSNVTPTLVESVFGGQLSSTVHCLECGH 209
+S K G + D E + K++ K P+ V+ +FGG+L+ST+ C +C
Sbjct: 317 VSKGILKAFGNSTEKLDEEVKNKVKDYEK----KKAIPSFVDRIFGGELTSTIMCDDCRT 372

Query: 208 ISVVYEAMLDLSLQIPTRQIPKKRQECEEQRNLNLPGGRSEESLQEDTKCEEQDGVLETQ 29
+S+V+E+ LDLSL + Q KK + + ++ E +D++ E+ D ++T+
Sbjct: 373 VSLVHESFLDLSLPVLDDQSGKKNINDKNVK-------KTMEEEDKDSEEEKDDSYMKTR 425

Query: 28 ETLIAST 8
+ + T
Sbjct: 426 SDVPSGT 432


>tr|Q6DIK6|Q6DIK6_XENTR Usp16 protein (Fragment) OS=Xenopus
tropicalis GN=usp16 PE=2 SV=1
Length = 548

Score = 55.1 bits (131), Expect = 2e-06
Identities = 34/93 (36%), Positives = 50/93 (53%)
Frame = -1

Query: 325 EEDKEHGKASKPSNVTPTLVESVFGGQLSSTVHCLECGHISVVYEAMLDLSLQIPTRQIP 146
EE K+ K S+ P V+ +FGG+L+ST+ C EC +S+V+E LDLSL + I
Sbjct: 335 EEIKKIVKDSEKRRTIPNFVDHLFGGELTSTIMCEECHTVSLVHEPFLDLSLPVLDDVIV 394

Query: 145 KKRQECEEQRNLNLPGGRSEESLQEDTKCEEQD 47
KK Q++ R EE +D +E+D
Sbjct: 395 KK----NSQKSSAPAPERKEEEENDDGYIKERD 423